PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK30089.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 160aa MW: 18217.2 Da PI: 6.2369 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.1 | 6.8e-12 | 25 | 81 | 3 | 59 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 el++ +r+ +NRe+ArrsR +K++ ++ L+ v L+++N + ++ ++++ ++ KFK30089.1 25 ELRKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKQNNEIVTSVSITTQHYLTV 81 68999***********************************98777666666666555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 8.8E-10 | 21 | 69 | No hit | No description |
SMART | SM00338 | 4.0E-17 | 23 | 87 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.841 | 25 | 88 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.0E-9 | 25 | 67 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.25E-12 | 26 | 80 | No hit | No description |
CDD | cd14702 | 7.64E-17 | 28 | 78 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 30 | 45 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009744 | Biological Process | response to sucrose | ||||
GO:0080149 | Biological Process | sucrose induced translational repression | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MESSSSGTTS SAIQTSSGSE ENLMELRKRK RMLSNRESAR RSRMKKQKLL DDLTAQVNHL 60 KKQNNEIVTS VSITTQHYLT VEAENSVLRA QLDELSHRLE SLNDIIEFLD NNNGSNTMFG 120 QDSSTSDDFL VNQMNINNNM FYMNHHQQSL MASSHDALLY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 26 | 47 | RKRKRMLSNRESARRSRMKKQK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00470 | DAP | Transfer from AT4G34590 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK30089.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF053940 | 3e-97 | AF053940.1 Arabidopsis thaliana transcription factor GBF6 (GBF6) mRNA, complete cds. | |||
GenBank | AL023094 | 3e-97 | AL023094.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20 (ESSA project). | |||
GenBank | AL161585 | 3e-97 | AL161585.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 81. | |||
GenBank | AY063979 | 3e-97 | AY063979.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds. | |||
GenBank | AY096396 | 3e-97 | AY096396.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds. | |||
GenBank | CP002687 | 3e-97 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
GenBank | X99747 | 3e-97 | X99747.1 A.thaliana ATB2 gene. | |||
GenBank | Z82043 | 3e-97 | Z82043.1 A.thaliana ATB2 gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009108720.2 | 8e-70 | PREDICTED: bZIP transcription factor 11-like | ||||
Swissprot | O65683 | 9e-63 | BZP11_ARATH; bZIP transcription factor 11 | ||||
TrEMBL | A0A087GJN7 | 1e-111 | A0A087GJN7_ARAAL; Uncharacterized protein | ||||
STRING | A0A087GJN7 | 1e-112 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM501 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 4e-63 | G-box binding factor 6 |