PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S01202.10 | ||||||||
Common Name | JCGZ_22363, LOC105628609 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 156aa MW: 18056.9 Da PI: 9.6075 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 150.6 | 7.5e-47 | 20 | 147 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 pGfrFhPt+eel+++yLkk v gk++ ++i+ +diy++ PwdLp +k++e+ewyfF++r++k+ +g r++r+t++gyWkatg+d+++ + Jcr4S01202.10 20 LPGFRFHPTEEELLDFYLKKMVLGKHFCS-NIITFLDIYHHAPWDLPGLAKTGEREWYFFVPRERKNGHGGRPSRITATGYWKATGSDRPIRCLtd 114 59************************888.89***************8889999*************************************98766 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++l gl+ktLvfy+grapkg ktdWvm+eyrl Jcr4S01202.10 115 PKRLLGLRKTLVFYTGRAPKGCKTDWVMNEYRL 147 7788***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.14E-52 | 15 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 48.512 | 19 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-24 | 21 | 147 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MEFGQLPEVY VSPSMEFGQL PGFRFHPTEE ELLDFYLKKM VLGKHFCSNI ITFLDIYHHA 60 PWDLPGLAKT GEREWYFFVP RERKNGHGGR PSRITATGYW KATGSDRPIR CLTDPKRLLG 120 LRKTLVFYTG RAPKGCKTDW VMNEYRLPTA CSLPKV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-44 | 14 | 147 | 10 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC775312 | 1e-153 | KC775312.1 Jatropha curcas NAC transcription factor 034 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012065446.1 | 1e-115 | NAC domain-containing protein 35 | ||||
Swissprot | Q10S65 | 2e-70 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | R4NHM3 | 1e-113 | R4NHM3_JATCU; NAC transcription factor 034 | ||||
STRING | cassava4.1_015927m | 7e-89 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6214 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 2e-75 | NAC domain containing protein 36 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105628609 |
Publications ? help Back to Top | |||
---|---|---|---|
|