PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.002G009300.1 | ||||||||
Common Name | B456_002G009300, LOC105773389 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 253aa MW: 28258.8 Da PI: 7.5601 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.3 | 9.7e-20 | 9 | 54 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++eEdell ++v+++G+++W+ I+ ++ gR++k+c++rw + Gorai.002G009300.1 9 RGPWSPEEDELLRKLVQRYGPRNWTVISTSIP-GRSGKSCRLRWCNQ 54 89******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.4e-17 | 63 | 105 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd ++ +a++++G++ W+tIar ++ gRt++ +k++w++ Gorai.002G009300.1 63 AFTAEEDRIIRKAHALYGNK-WATIARLLN-GRTDNAVKNHWNST 105 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.255 | 4 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.68E-31 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.8E-17 | 8 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-19 | 9 | 54 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-25 | 10 | 61 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.10E-15 | 11 | 53 | No hit | No description |
SMART | SM00717 | 1.9E-15 | 60 | 108 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.074 | 61 | 110 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-22 | 62 | 110 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.54E-11 | 63 | 106 | No hit | No description |
Pfam | PF00249 | 8.8E-15 | 63 | 105 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 253 aa Download sequence Send to blast |
MGQDIDRVRG PWSPEEDELL RKLVQRYGPR NWTVISTSIP GRSGKSCRLR WCNQLSPEVE 60 HRAFTAEEDR IIRKAHALYG NKWATIARLL NGRTDNAVKN HWNSTLKRKF IEDSESEKKP 120 AKSPRTASSS SPSRSDANDL GLGVVADELS QCSRVSTKLT LRSSWNESVD LNNDDDHLSK 180 ENDLKLTSEK HENDSSATVA AAMLPPEILA AAMLPPEILA AIKEMIKKEV RGYMEEFGFR 240 SESVKNAIGN IE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-41 | 8 | 110 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012450684.1 | 0.0 | PREDICTED: transcription factor MYB44-like isoform X1 | ||||
Swissprot | Q9FDW1 | 2e-63 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A0D2PYV4 | 0.0 | A0A0D2PYV4_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.002G009300.1 | 0.0 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM24269 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 5e-64 | myb domain protein r1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.002G009300.1 |
Entrez Gene | 105773389 |