PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

bZIP

Protein Properties

Length: 161aa MW: 17688.8 Da PI: 7.7828

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.12G040600.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	42	2e-13	30	88	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NRe+ArrsR RK++ ++ L v++L +eN++ ++ ++++ ++++e+ Glyma.12G040600.1.p 30 RKRKRMISNRESARRSRMRKQKHLDDLVSQVAQLRKENQQILTSVNITTQQYLSVEAEN 88 6789************************************9999999999998888776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.2E-18	26	90	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.749	28	91	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.2E-11	29	105	No hit	No description
Pfam	PF00170	2.3E-10	30	77	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.06E-13	30	82	No hit	No description
CDD	cd14702	4.72E-21	31	81	No hit	No description
PROSITE pattern	PS00036	0	33	48	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009845	Biological Process	seed germination
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MASSSGTSSG SSLLQNSGSE EDLQAVMDQR KRKRMISNRE SARRSRMRKQ KHLDDLVSQV 60 AQLRKENQQI LTSVNITTQQ YLSVEAENSV LRAQVGELSH RLESLNEIVD VLNATTVAGF 120 GAAATSSTFV EPINNNSFFN PLNMGYLNHP IMASADILQY *

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	29	50	RKRKRMISNRESARRSRMRKQK
2	42	49	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.7045	0.0	flower\| leaf\| meristem\| root\| seed coat\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269\|PubMed:23461773}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00239	DAP	Transfer from AT1G75390	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.12G040600.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT096484	0.0	BT096484.1 Soybean clone JCVI-FLGm-9L12 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001238344.1	1e-114	bZIP transcription factor bZIP124
Refseq	XP_028194801.1	1e-114	bZIP transcription factor 11-like
Swissprot	C0Z2L5	1e-51	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	A0A445HKP6	1e-113	A0A445HKP6_GLYSO; BZIP transcription factor 44
TrEMBL	Q0GPF8	1e-113	Q0GPF8_SOYBN; BZIP transcription factor
STRING	GLYMA12G04440.1	1e-113	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF613	34	147
Representative plant	OGRP551	16	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34590.1	6e-48	G-box binding factor 6

Link Out ? help Back to Top
Phytozome	Glyma.12G040600.1.p
Entrez Gene	100101862

Publications ? help Back to Top
Liao Y, et al. Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis. Planta, 2008. 228(2): p. 225-40 [PMID:18365246] Chai C, et al. Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance. BMC Genomics, 2015. 16: p. 596 [PMID:26268547] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]