PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.04G211200.1.p | ||||||||
Common Name | GLYMA_04G211200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 148aa MW: 16887.8 Da PI: 6.6746 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 74.8 | 1.3e-23 | 17 | 65 | 2 | 50 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtsea 50 +eqdrflPianv+r mkk++P+n kiskdaketvqecvsefisf +e Glyma.04G211200.1.p 17 KEQDRFLPIANVGRFMKKAIPGNVKISKDAKETVQECVSEFISFKYKEI 65 89******************************************88775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.0E-21 | 13 | 60 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.72E-14 | 13 | 60 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.6E-13 | 22 | 60 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MEDESHSNLP NGTCSNKEQD RFLPIANVGR FMKKAIPGNV KISKDAKETV QECVSEFISF 60 KYKEIEGEKI NIPKQQRSEQ RLHQQQHQHP HQDQNNNLPL SSVYSSPNLI SQPPYVATDQ 120 LFFLPFSPNS IQKQLQPQDQ IDSVGQW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-17 | 17 | 60 | 2 | 45 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-17 | 17 | 60 | 2 | 45 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.04G211200.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027361313.1 | 1e-73 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q9SIT9 | 4e-25 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | A0A0R0KIC7 | 1e-104 | A0A0R0KIC7_SOYBN; Uncharacterized protein | ||||
STRING | XP_007137789.1 | 2e-60 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 3e-24 | nuclear factor Y, subunit B7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.04G211200.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|