![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A10G0638 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 170aa MW: 19623.2 Da PI: 9.9596 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 106.1 | 1.7e-33 | 91 | 149 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+++v +tYeg H+h+ Gh_A10G0638 91 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDETLVLTTYEGVHTHP 149 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-34 | 76 | 149 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.84E-30 | 83 | 150 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.62 | 86 | 151 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-39 | 91 | 150 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.4E-27 | 92 | 149 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MFLPVSLPSN MAFNSQVFDN FHGDTSNGML LSDMKTNKLI QAAQVKEVVE NGGFVGSETE 60 IKSGGDRNKK KEKKTRKPRY AFQTRSQVDI LDDGYRWRKY GQKAVKNNKF PRSYYRCTHQ 120 GCNVKKQVQR LTKDETLVLT TYEGVHTHPI DNPTDDFHHI LSQMQIYTPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-27 | 81 | 148 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-27 | 81 | 148 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.23261 | 1e-54 | boll |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF669847 | 0.0 | KF669847.1 Gossypium hirsutum WRKY transcription factor 94 (WRKY94) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016676722.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 1e-53 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A1U8IF73 | 1e-126 | A0A1U8IF73_GOSHI; probable WRKY transcription factor 75 | ||||
STRING | Gorai.011G086300.1 | 1e-116 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 7e-56 | WRKY DNA-binding protein 75 |