PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A03G0301

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

WOX

Protein Properties

Length: 201aa MW: 22953.2 Da PI: 9.1133

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A03G0301	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	64.6	1.4e-20	7	66	3	57
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++t+eq+ +Lee++++ ++p+a+++++++++l +++ ++V++WFqN++a+e++ Gh_A03G0301 7 SRWCPTPEQVMILEEMYRSgVKTPNATQIQQITSHLsfygKIEGKNVFYWFQNHKARERQ 66 7***************99************************************97 PP
2	Wus_type_Homeobox	120.3	7.9e-39	6	67	3	64
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++RW+PtpeQ++iLee+y+sG++tPn+ +iq+it++L+ yGkie+kNVfyWFQN+kaRerqk Gh_A03G0301 6 SSRWCPTPEQVMILEEMYRSGVKTPNATQIQQITSHLSFYGKIEGKNVFYWFQNHKARERQK 67 79***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00389	2.6E-4	4	71	IPR001356	Homeobox domain
Pfam	PF00046	2.8E-18	7	66	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	5.8E-8	7	66	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.88E-11	7	67	IPR009057	Homeodomain-like
CDD	cd00086	6.56E-5	8	67	No hit	No description
PROSITE profile	PS50071	10.042	12	67	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 201 aa Download sequence Send to blast
MCPAGSSRWC PTPEQVMILE EMYRSGVKTP NATQIQQITS HLSFYGKIEG KNVFYWFQNH 60 KARERQKLRR KLSKQLQLQQ QQLFHHYFDS LPSPPFQHLS YYNSPPPFPQ QVGVHDAAAA 120 AKQGMNYTWK LDVSERMDVD KSMMKIYGGD LLMMVDLSSP SLSSPCFFTT TTTGPPPLKT 180 LELFPVTASN LKEECNKNNN G

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:14711878}.
Uniprot	TISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269\|PubMed:11751640}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016667681.1	1e-152	PREDICTED: WUSCHEL-related homeobox 3-like isoform X1
Swissprot	Q9SIB4	3e-46	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	A0A1U8HNT2	1e-150	A0A1U8HNT2_GOSHI; WUSCHEL-related homeobox 3-like isoform X1
STRING	Gorai.003G138900.1	1e-130	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7480	26	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28610.1	1e-36	WOX family protein

Publications ? help Back to Top
Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]