PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr8P04330_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 245aa MW: 27874.7 Da PI: 8.0678 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99 | 1.9e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeys+ GSMUA_Achr8P04330_001 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 89 | 9.2e-30 | 84 | 159 | 10 | 85 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 +++ + +++ e+ +Lk++ie Lq++qRhl+Ge+Le+L+lkeLqqLeqqLe++l+kiRs+Kn++l+++i+elq+k GSMUA_Achr8P04330_001 84 DTEVQGNWCLEYGQLKAKIEALQTSQRHLVGEQLEKLTLKELQQLEQQLETALRKIRSRKNNVLFDSIHELQRKAI 159 4555779******************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.912 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-34 | 2 | 87 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.89E-43 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 1.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.3E-25 | 86 | 159 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.289 | 88 | 189 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLYEYSTD 60 SSMERILERY QQYSYAERAL LEADTEVQGN WCLEYGQLKA KIEALQTSQR HLVGEQLEKL 120 TLKELQQLEQ QLETALRKIR SRKNNVLFDS IHELQRKAIG LKCGMHGFFI QIKEKNKEAE 180 EALSQQQQAE HQAPAETSSS PPDLLSTDST INVGNYQATG AVVEEAEQPL AQTTSSVLPP 240 WMLRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009412364.1 | 1e-150 | PREDICTED: truncated transcription factor CAULIFLOWER A-like | ||||
Swissprot | A2YNI2 | 8e-92 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
Swissprot | Q0D4T4 | 8e-92 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
TrEMBL | M0TMI6 | 1e-180 | M0TMI6_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr8P04330_001 | 1e-180 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1151 | 37 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 4e-69 | MIKC_MADS family protein |