![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr11P21460_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 153aa MW: 17887.4 Da PI: 9.9241 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.8 | 3.4e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtfskRrng+lKKA+ELSvLCd+e+ +i+fs++gklye+ss GSMUA_Achr11P21460_001 9 KRIENAASRQVTFSKRRNGLLKKAFELSVLCDVEIGLIVFSPRGKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 41.2 | 6.9e-15 | 76 | 141 | 5 | 70 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 +++s++ ++ ++ + e++ L k++e L+ ++ ++lGe+L+s+ eL ++e+++eksl++iR++K GSMUA_Achr11P21460_001 76 DTSSTTREQDAKRKYEAESLSKKLEDLEASKQKFLGEKLDSCLSDELYEIERKIEKSLRSIRARKA 141 334467777888999**************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.5E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.754 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.14E-32 | 3 | 84 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.93E-38 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.2E-14 | 83 | 141 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 7.855 | 85 | 153 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MVRGKTEMKR IENAASRQVT FSKRRNGLLK KAFELSVLCD VEIGLIVFSP RGKLYEFSSS 60 SLQSTIERYR ERTKEDTSST TREQDAKRKY EAESLSKKLE DLEASKQKFL GEKLDSCLSD 120 ELYEIERKIE KSLRSIRARK ASHDSFNFYC KFF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-18 | 1 | 81 | 1 | 81 | MEF2C |
5f28_B | 4e-18 | 1 | 81 | 1 | 81 | MEF2C |
5f28_C | 4e-18 | 1 | 81 | 1 | 81 | MEF2C |
5f28_D | 4e-18 | 1 | 81 | 1 | 81 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF207699 | 2e-48 | AF207699.1 Elaeis guineensis agamous-like MADS box protein OPMADS1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009384512.1 | 1e-93 | PREDICTED: MADS-box transcription factor 50-like | ||||
Swissprot | Q9XJ60 | 2e-59 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
TrEMBL | M0RU76 | 1e-104 | M0RU76_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr11P21460_001 | 1e-105 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1413 | 33 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 1e-59 | AGAMOUS-like 20 |