![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00149966001 | ||||||||
Common Name | GSBRNA2T00149966001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 210aa MW: 23897.3 Da PI: 6.2325 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.3 | 8e-57 | 34 | 129 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 +eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plkvyl+kyr GSBRNA2T00149966001 34 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLNKYR 123 89**************************************************************************************** PP NF-YB 92 elegek 97 e+egek GSBRNA2T00149966001 124 ETEGEK 129 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.6E-55 | 27 | 154 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.16E-42 | 36 | 155 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.9E-28 | 39 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.9E-19 | 67 | 85 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.9E-19 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 2.9E-19 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MTEESPEEDH ESPGVAETNL GSPSSKNNNN NNNKEQDRFL PIANVGRIMK KVLPGNGKIS 60 KDAKETVQEC VSEFISFVTG EASDKCQREK RKTINGDDII WAITTLGFED YVAPLKVYLN 120 KYRETEGEKT NSPKQRQQQQ VQQNHHFQFQ EQDHNNISCT SYMSHHHPSP FFPADHQPFP 180 NLPFSPKSLQ KQFPQQQHDN TDSIGQWSV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-45 | 34 | 124 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 34 | 124 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00149966001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC787668 | 0.0 | KC787668.1 Brassica napus transcription factor subunit NF-YB7A (NF-YB7A) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009136216.1 | 1e-155 | PREDICTED: nuclear transcription factor Y subunit B-7-like | ||||
Swissprot | Q9SIT9 | 1e-116 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | A0A3P5ZP76 | 1e-154 | A0A3P5ZP76_BRACM; Uncharacterized protein | ||||
TrEMBL | M4D9I3 | 1e-154 | M4D9I3_BRARP; Uncharacterized protein | ||||
STRING | Bra013143.1-P | 1e-155 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 1e-110 | nuclear factor Y, subunit B7 |
Publications ? help Back to Top | |||
---|---|---|---|
|