PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00140320001 | ||||||||
Common Name | GSBRNA2T00140320001, LOC106379107 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 148aa MW: 17019.9 Da PI: 9.6481 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.3 | 6.4e-33 | 67 | 125 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt+agC+vkk+v+r ++d++vv++tYeg H h GSBRNA2T00140320001 67 LDDGYRWRKYGQKAVKNNTFPRSYYRCTYAGCNVKKQVQRLTSDQEVVVTTYEGVHSHA 125 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.8E-34 | 52 | 125 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.62E-29 | 59 | 125 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.849 | 62 | 127 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.8E-38 | 67 | 126 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-26 | 68 | 124 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MEGYQNGSSY APFLSLTSHQ NLAKSEFHQG EEEASKVREG SSRSLEVKKK GKKQRFAFQT 60 RSQVDILDDG YRWRKYGQKA VKNNTFPRSY YRCTYAGCNV KKQVQRLTSD QEVVVTTYEG 120 VHSHAIEKST ENFEHILTQM QIYSSFN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 7e-30 | 57 | 127 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 7e-30 | 57 | 127 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.29080 | 0.0 | leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00140320001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU912417 | 0.0 | EU912417.1 Brassica napus WRKY75-1 transcription factor (WRKY75-1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013626795.1 | 1e-107 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_013674576.1 | 1e-107 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 3e-79 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A0D3B0W4 | 1e-106 | A0A0D3B0W4_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6A9D0 | 1e-106 | A0A3P6A9D0_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g008970.1 | 1e-107 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 1e-81 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106379107 |