![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00126445001 | ||||||||
Common Name | BnAP3, GSBRNA2T00126445001, LOC106449291 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 225aa MW: 26378.8 Da PI: 8.6586 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.8 | 7.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+e++s GSBRNA2T00126445001 9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFIS 59 79***********************************************86 PP | |||||||
2 | K-box | 80.5 | 4.1e-27 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 yq+ s++++++a++e++q+ +kL + ++nL+++++++lGe+L++L+++eL++Le+++e+ k +R++K + l +qie+++kk+k++q++ GSBRNA2T00126445001 71 YQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDI 160 78899999********************************************************************************** PP K-box 91 nkaLrkkle 99 +k+L ++le GSBRNA2T00126445001 161 QKNLIHELE 169 ****99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.226 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.21E-40 | 2 | 80 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.01E-36 | 3 | 94 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.5E-16 | 82 | 168 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.906 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEFISP 60 NTTTKEIIDL YQTVSDVDVW SAHYERMQET KRKLLETNRN LRTQIKQRLG ECLDELDIQE 120 LRSLEEEMEN TFKLVRERKF KSLGNQIETT KKKNKSQQDI QKNLIHELEL RAEDPHYGLV 180 DNGGDYDSVL GYQLRFHQNH HHHYPNHALH AASASDIITF HLLE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 2e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 2e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 2e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.7355 | 1e-178 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in petals and stamens. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00126445001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF124814 | 0.0 | AF124814.1 Brassica napus APETALA3 (BnAP3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001302937.1 | 1e-167 | floral homeotic protein APETALA 3-like | ||||
Swissprot | P35632 | 1e-158 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
TrEMBL | A0A397ZQB5 | 1e-165 | A0A397ZQB5_BRACM; Uncharacterized protein | ||||
TrEMBL | Q6IV03 | 1e-165 | Q6IV03_BRARC; Floral homeotic protein APETALA3 | ||||
TrEMBL | Q9M7M0 | 1e-165 | Q9M7M0_BRANA; APETALA3-4 | ||||
STRING | Bra014822.1-P | 1e-166 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5261 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 1e-145 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106449291 |