![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00001940001 | ||||||||
Common Name | GSBRNA2T00001940001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 232aa MW: 25910 Da PI: 6.6305 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.5 | 1.1e-54 | 53 | 149 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++y GSBRNA2T00001940001 53 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRY 142 69**************************************************************************************** PP NF-YB 91 relegek 97 releg++ GSBRNA2T00001940001 143 RELEGDR 149 *****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.3E-50 | 49 | 150 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.01E-37 | 56 | 151 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.2E-25 | 59 | 123 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.1E-16 | 87 | 105 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 90 | 106 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.1E-16 | 106 | 124 | No hit | No description |
PRINTS | PR00615 | 1.1E-16 | 125 | 143 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MERGGFHGYR KFSLNTTNPS EPAKFLMAEG SMQLSEPNQT NKTANGGEEE CTVREQDRFM 60 PIANVIRIMR RILPAHAKIS DDSKETIQEC VSEYISFITG EANERCQREQ RKTITAEDVL 120 WAMSKLGFDD YIEPLTLYLH RYRELEGDRG VGYNTGSVGM TSGMVVKRPN GAMAEYGAYG 180 VVPGMHMAPY HYRHQNGYGY SGNEPDSKMG GPSSAANGSR VELFPTQQHK Y* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 7e-65 | 52 | 144 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00001940001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC236785 | 0.0 | AC236785.1 Brassica napus clone JBnB015G17, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009101397.2 | 1e-175 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 1e-140 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A078FT61 | 1e-174 | A0A078FT61_BRANA; BnaA06g35340D protein | ||||
TrEMBL | A0A397Z814 | 1e-174 | A0A397Z814_BRACM; Uncharacterized protein | ||||
TrEMBL | M4E818 | 1e-174 | M4E818_BRARP; Uncharacterized protein | ||||
STRING | Bra024924.1-P | 1e-174 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9896 | 26 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 1e-143 | nuclear factor Y, subunit B6 |