PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MYB

Protein Properties

Length: 304aa MW: 32165.1 Da PI: 8.7123

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G145444_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.7	6.3e-19	11	56	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + GRMZM2G145444_P01 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56 79****************************.*********985 PP
2	Myb_DNA-binding	55.4	1.4e-17	63	106	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eEd ++ a+++lG++ W++Iar ++ gRt++ +k++w++ GRMZM2G145444_P01 63 RRPFTPEEDAAILAAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.481	6	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.68E-31	8	104	IPR009057	Homeodomain-like
SMART	SM00717	9.6E-17	10	59	IPR001005	SANT/Myb domain
Pfam	PF00249	3.9E-18	11	56	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.8E-25	12	64	IPR009057	Homeodomain-like
CDD	cd00167	3.99E-16	13	55	No hit	No description
SMART	SM00717	5.6E-16	62	110	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.861	63	112	IPR017930	Myb domain
Pfam	PF00249	3.6E-15	63	106	IPR001005	SANT/Myb domain
CDD	cd00167	1.05E-12	65	108	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.5E-24	65	112	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 304 aa Download sequence Send to blast
MGVESECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ 60 VERRPFTPEE DAAILAAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KLATATATSS 120 GSDAERACKR ASPGPGSPTA SDRSDLSHGC GAAQVFRPVP RAGGFDAISA ADVRPPPPPA 180 VADEDPLTSL SLSLPGLDQS PSGFHHDSAR SHFQELSPSS SPSPQSTPPA FPPQAAPSQS 240 SYAFSGELVA AMQEMIRAEV RKYMSGAGLR AGCGPGAVGE VCMPQLVEGV MRAAAERVGV 300 VTRP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-41	8	114	4	110	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.6005	0.0	ear\| endosperm\| meristem\| ovary\| pollen\| shoot

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G145444

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269\|PubMed:9678577}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:9678577}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00653	PBM	Transfer from LOC_Os02g09480	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G145444_P01

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT038391	0.0	BT038391.1 Zea mays full-length cDNA clone ZM_BFb0229K03 mRNA, complete cds.
GenBank	EU956045	0.0	EU956045.1 Zea mays clone 1556153 MYB transcription factor TaMYB1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001147631.1	0.0	uncharacterized protein LOC100281240
Swissprot	Q9FDW1	4e-70	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A3L6ENE5	0.0	A0A3L6ENE5_MAIZE; Transcription factor MYB44
TrEMBL	B4FMQ3	0.0	B4FMQ3_MAIZE; MYB transcription factor
STRING	GRMZM2G145444_P01	0.0	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	3e-62	myb domain protein r1

Link Out ? help Back to Top
Phytozome	GRMZM2G145444_P01
Entrez Gene	100281240

Publications ? help Back to Top
Alexandrov NN, et al. Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol., 2009. 69(1-2): p. 179-94 [PMID:18937034] Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]