![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.L03029.1.p | ||||||||
Common Name | EUGRSUZ_F02403 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 96aa MW: 10839.8 Da PI: 11.706 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.7 | 8.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRrng+lKKA+ELSvLCdaeva+ii+ ++gklye+ss Eucgr.L03029.1.p 9 KRIENNTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIVFPRGKLYEFSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.221 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.40E-34 | 3 | 60 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.54E-28 | 3 | 61 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MVRGKTRMKR IENNTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIVFP RGKLYEFSSS 60 TRRPPERSVR ILCFACTFAN LANGEPRFRA MKLGG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_B | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_C | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_D | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
6byy_A | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_B | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_C | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_D | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_A | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_B | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_C | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_D | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.L03029.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF086642 | 2e-84 | AF086642.1 Eucalyptus globulus subsp. globulus putative MADS box transcription factor ETL mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010042316.1 | 2e-63 | PREDICTED: agamous-like MADS-box protein AGL14 isoform X1 | ||||
Swissprot | Q38838 | 4e-32 | AGL14_ARATH; Agamous-like MADS-box protein AGL14 | ||||
TrEMBL | A0A059BS54 | 6e-61 | A0A059BS54_EUCGR; Uncharacterized protein | ||||
STRING | XP_010042316.1 | 8e-63 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 2e-34 | AGAMOUS-like 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.L03029.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|