 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Eucgr.L03029.1.p |
Common Name | EUGRSUZ_F02403 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
Family |
M-type_MADS |
Protein Properties |
Length: 96aa MW: 10839.8 Da PI: 11.706 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Eucgr.L03029.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 93.7 | 8.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++ rqvtfskRrng+lKKA+ELSvLCdaeva+ii+ ++gklye+ss
Eucgr.L03029.1.p 9 KRIENNTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIVFPRGKLYEFSS 59
79***********************************************96 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
3mu6_A | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_B | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_C | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_D | 2e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
6byy_A | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_B | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_C | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_D | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_A | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_B | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_C | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_D | 3e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AF086642 | 2e-84 | AF086642.1 Eucalyptus globulus subsp. globulus putative MADS box transcription factor ETL mRNA, complete cds. |