![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC027316.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 162aa MW: 18155.5 Da PI: 10.8118 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.8 | 1.7e-10 | 52 | 97 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g W++eEd l +v+ G+ +W++I+r++ g ++k+c++rw + EcC027316.10 52 KGLWSAEEDRVLNGLVEWCGPWNWSLISRHIE-GQSGKSCRLRWCNQ 97 678*****************88**********.***********985 PP | |||||||
2 | Myb_DNA-binding | 27.6 | 6.7e-09 | 107 | 144 | 4 | 43 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +++ d+ ++ +++ +G++ W+tIa ++ gRt++ +k++ EcC027316.10 107 FSAAKDDAILAVHAVYGNR-WTTIAWLLP-GRTDNAIKNH 144 55666889999********.*********.*********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.114 | 47 | 102 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.39E-25 | 49 | 144 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-5 | 51 | 100 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.4E-19 | 53 | 105 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.56E-7 | 55 | 96 | No hit | No description |
Pfam | PF13921 | 2.3E-12 | 55 | 112 | No hit | No description |
SMART | SM00717 | 0.0041 | 103 | 151 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 8.791 | 103 | 156 | IPR017930 | Myb domain |
CDD | cd00167 | 1.31E-4 | 106 | 144 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-15 | 106 | 144 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MVLLFAYVEC KTHLIFFRSS PACSSSSSNS SSFNSSSRKN PASSTRKINR VKGLWSAEED 60 RVLNGLVEWC GPWNWSLISR HIEGQSGKSC RLRWCNQLSP DIKHRPFSAA KDDAILAVHA 120 VYGNRWTTIA WLLPGRTDNA IKNHGTPLSR EGPPRSRRTT GQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-27 | 51 | 144 | 6 | 99 | B-MYB |
1gv2_A | 1e-27 | 51 | 144 | 3 | 96 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-27 | 51 | 144 | 3 | 96 | C-Myb DNA-Binding Domain |
1msf_C | 1e-27 | 51 | 144 | 3 | 96 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010061776.1 | 7e-63 | PREDICTED: transcription factor MYB44 | ||||
Swissprot | Q9SN12 | 1e-38 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A059BRN8 | 2e-61 | A0A059BRN8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061776.1 | 3e-62 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14553 | 11 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23290.1 | 3e-42 | myb domain protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|