![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT07746 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 104aa MW: 11216.1 Da PI: 10.8564 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 64.8 | 9.3e-21 | 18 | 65 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 rie++ rqv fskRr+g++KK +EL vLC+aeva ++fs+ gk + + EMT07746 18 RIESEEARQVCFSKRRAGLFKKVSELAVLCGAEVAAVVFSPAGKAFSF 65 8******************************************98766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 26.324 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.7E-33 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.15E-29 | 9 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.31E-37 | 10 | 77 | No hit | No description |
PRINTS | PR00404 | 1.8E-20 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.9E-26 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-20 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-20 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MAPKRKLSMG RQKIEIRRIE SEEARQVCFS KRRAGLFKKV SELAVLCGAE VAAVVFSPAG 60 KAFSFGHPSV EAILDRFIPS AAQLGVAGAG AGKMREKRLE AEAN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 8e-18 | 9 | 98 | 1 | 94 | MEF2 CHIMERA |
6bz1_B | 8e-18 | 9 | 98 | 1 | 94 | MEF2 CHIMERA |
6bz1_C | 8e-18 | 9 | 98 | 1 | 94 | MEF2 CHIMERA |
6bz1_D | 8e-18 | 9 | 98 | 1 | 94 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 1e-98 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020199886.1 | 1e-57 | agamous-like MADS-box protein AGL29 | ||||
Swissprot | Q4PSU4 | 6e-29 | AGL61_ARATH; Agamous-like MADS-box protein AGL61 | ||||
TrEMBL | M8B194 | 3e-66 | M8B194_AEGTA; Uncharacterized protein | ||||
STRING | EMT07746 | 5e-67 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1224 | 36 | 128 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24840.1 | 1e-26 | AGAMOUS-like 61 |
Publications ? help Back to Top | |||
---|---|---|---|
|