PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do019739.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

M-type_MADS

Protein Properties

Length: 169aa MW: 19183.5 Da PI: 9.4351

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do019739.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	79.4	2.5e-25	11	60	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k rqv f+kRr g++KKA+EL LCdaeva+++fs+ gklyeyss Do019739.1 11 RIEDKASRQVRFCKRRSGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 60 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.8E-32	2	61	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.693	2	62	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.15E-38	3	79	No hit	No description
PRINTS	PR00404	6.2E-27	4	24	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.19E-30	4	86	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.3E-24	11	58	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.2E-27	24	39	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.2E-27	39	60	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MARRGRVELR RIEDKASRQV RFCKRRSGLF KKAFELALLC DAEVALLVFS PAGKLYEYSS 60 TSIEDTYDRY QRFAGAGRNV NEGDRNNNNS QDAAASDLQS RVREIATWSE QNNAEESDAN 120 ELGKLEKLLT NALRDTKNKK VHLSGFVFYI ITRDLDKDHP TGSVCSKKT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3kov_B	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3kov_I	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3kov_J	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_A	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_B	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_C	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_D	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_I	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_J	5e-17	4	73	2	71	Myocyte-specific enhancer factor 2A
5f28_A	5e-17	4	73	3	72	MEF2C
5f28_B	5e-17	4	73	3	72	MEF2C
5f28_C	5e-17	4	73	3	72	MEF2C
5f28_D	5e-17	4	73	3	72	MEF2C
6byy_A	6e-17	4	74	3	73	MEF2 CHIMERA
6byy_B	6e-17	4	74	3	73	MEF2 CHIMERA
6byy_C	6e-17	4	74	3	73	MEF2 CHIMERA
6byy_D	6e-17	4	74	3	73	MEF2 CHIMERA
6bz1_A	7e-17	4	74	3	73	MEF2 CHIMERA
6bz1_B	7e-17	4	74	3	73	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do019739.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004971093.1	2e-87	MADS-box transcription factor 51
Swissprot	Q9XJ61	1e-70	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A2T7DCB2	1e-84	A0A2T7DCB2_9POAL; Uncharacterized protein
STRING	Pavir.J02739.1.p	7e-86	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	4e-29	AGAMOUS-like 20

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465]