PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do010550.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

MIKC_MADS

Protein Properties

Length: 152aa MW: 17158.8 Da PI: 9.9683

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do010550.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	86	2.1e-27	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtfskRr+g+ KKA E+ vLCdaev v+ifss gkly+y+s Do010550.1 9 KRIENSTNRQVTFSKRRAGLVKKAREIGVLCDAEVGVVIFSSGGKLYDYCS 59 79***********************************************96 PP
2	K-box	63.4	8.3e-22	71	138	1	68
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRsk 68 yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+ +eL +e++L+++ ++ R+k Do010550.1 71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHLKGEDLNSLQPRELIAIEEALQNGQTNLRDK 138 89999999**********************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.8E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.043	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.09E-33	2	96	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.58E-42	2	80	No hit	No description
PRINTS	PR00404	3.3E-29	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.8E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.3E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.3E-29	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.8E-12	82	138	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	9.778	84	152	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010093	Biological Process	specification of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 152 aa Download sequence Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGLVK KAREIGVLCD AEVGVVIFSS GGKLYDYCSP 60 RTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRHLKG EDLNSLQPRE 120 LIAIEEALQN GQTNLRDKMA ILHPLAPISI AS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
1tqe_R	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
1tqe_S	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
5f28_A	2e-20	1	86	1	78	MEF2C
5f28_B	2e-20	1	86	1	78	MEF2C
5f28_C	2e-20	1	86	1	78	MEF2C
5f28_D	2e-20	1	86	1	78	MEF2C
6c9l_A	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
6c9l_B	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
6c9l_C	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
6c9l_D	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
6c9l_E	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
6c9l_F	2e-20	1	86	1	78	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269\|PubMed:9869408}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00080	ChIP-seq	Transfer from AT5G20240	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do010550.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KU740312	1e-173	KU740312.1 Eriachne aristidea PISTILLATA-like MADS-box transcription factor PI-1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004962034.1	1e-96	MADS-box transcription factor 4
Swissprot	Q40703	5e-89	MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBL	A0A1E5VSA3	1e-107	A0A1E5VSA3_9POAL; MADS-box transcription factor 4
STRING	Si023214m	6e-96	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3434	38	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G20240.1	1e-62	MIKC_MADS family protein

Publications ? help Back to Top
Ronai Z, et al. Transcription factor binding study by capillary zone electrophoretic mobility shift assay. Electrophoresis, 2003. 24(1-2): p. 96-100 [PMID:12652578] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kang HG,An G Morphological alterations by ectopic expression of the rice OsMADS4 gene in tobacco plants. Plant Cell Rep., 2005. 24(2): p. 120-6 [PMID:15703945] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Chen C, et al. Adapting rice anther culture to gene transformation and RNA interference. Sci. China, C, Life Sci., 2006. 49(5): p. 414-28 [PMID:17172048] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Wang H, et al. OsMADS32 interacts with PI-like proteins and regulates rice flower development. J Integr Plant Biol, 2015. 57(5): p. 504-13 [PMID:25081486]