PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa08g044170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25409 Da PI: 9.3587 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.8 | 9.1e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss Csa08g044170.1 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 76.9 | 5.5e-26 | 82 | 172 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + ++++++ e L ++ie L+ + R+++Ge+L+ s++eLqqLe+qL++sl kiR kK++ll+e+ie+l++ke++l enk+L +k e Csa08g044170.1 82 KRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRGKKYQLLREEIEKLKEKERNLVAENKMLMEKCE 172 56778999*******************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.071 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.32E-32 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.11E-41 | 3 | 72 | No hit | No description |
Pfam | PF00319 | 5.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.5E-25 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.455 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010082 | Biological Process | regulation of root meristem growth | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:2000012 | Biological Process | regulation of auxin polar transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSSS 60 SSIPKTVERY QKRIQDLGPN HKRNDNSQQS KDETYGLARK IEHLEISTRK MMGEGLDASS 120 IEELQQLENQ LDRSLMKIRG KKYQLLREEI EKLKEKERNL VAENKMLMEK CEMGGRGIVA 180 RTSSSTTTEE VDIDDNEMEV VTDLFIGPPE TRHSKKFPPP N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa08g044170.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK230464 | 0.0 | AK230464.1 Arabidopsis thaliana mRNA for MADS-box protein AGL14, complete cds, clone: RAFL26-03-G06. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010422139.1 | 1e-162 | PREDICTED: agamous-like MADS-box protein AGL14 | ||||
Swissprot | Q38838 | 1e-136 | AGL14_ARATH; Agamous-like MADS-box protein AGL14 | ||||
TrEMBL | D7M0B6 | 1e-134 | D7M0B6_ARALL; Uncharacterized protein | ||||
STRING | XP_010422139.1 | 1e-161 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 1e-135 | AGAMOUS-like 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|