PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10029776m | ||||||||
Common Name | CICLE_v10029776mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 64aa MW: 7242.39 Da PI: 11.0568 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.2 | 1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCdaeva+i+fs+tg+l++yss Ciclev10029776m 9 KKIDNPTARQVTFSKRRRGLFKKAQELSTLCDAEVALIVFSTTGRLFDYSS 59 68***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.73 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.9E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-28 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.10E-34 | 3 | 62 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MTRQKIEIKK IDNPTARQVT FSKRRRGLFK KAQELSTLCD AEVALIVFST TGRLFDYSSS 60 RFG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-18 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 3e-18 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 3e-18 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 3e-18 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006423752.2 | 4e-37 | MADS-box protein JOINTLESS isoform X4 | ||||
Refseq | XP_006487504.1 | 4e-37 | MADS-box protein JOINTLESS-like isoform X3 | ||||
Refseq | XP_015388512.1 | 4e-37 | MADS-box protein JOINTLESS-like isoform X4 | ||||
Refseq | XP_024035082.1 | 4e-37 | MADS-box protein JOINTLESS isoform X3 | ||||
Swissprot | Q9FUY6 | 9e-30 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | V4SDT3 | 7e-38 | V4SDT3_9ROSI; Uncharacterized protein | ||||
STRING | XP_006423754.1 | 1e-38 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 3e-30 | AGAMOUS-like 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10029776m |
Entrez Gene | 18033853 |
Publications ? help Back to Top | |||
---|---|---|---|
|