PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

M-type_MADS

Protein Properties

Length: 77aa MW: 8699.32 Da PI: 10.8074

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10023160m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.2	8.2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss Ciclev10023160m 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.399	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.7E-40	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.06E-30	3	64	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.4E-32	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.87E-39	3	59	No hit	No description
Pfam	PF00319	5.0E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.4E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.4E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSSC 60 RCVPHLLRNV LTDTLI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	7e-18	3	68	2	67	Myocyte-specific enhancer factor 2A
3mu6_B	7e-18	3	68	2	67	Myocyte-specific enhancer factor 2A
3mu6_C	7e-18	3	68	2	67	Myocyte-specific enhancer factor 2A
3mu6_D	7e-18	3	68	2	67	Myocyte-specific enhancer factor 2A
5f28_A	7e-18	1	68	1	68	MEF2C
5f28_B	7e-18	1	68	1	68	MEF2C
5f28_C	7e-18	1	68	1	68	MEF2C
5f28_D	7e-18	1	68	1	68	MEF2C
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During floral transition, expressed very early at the flanks of the inflorescence meristem in the anlagens upon the transition to flowering Subsequently, expression levels increase in the first and second stages of the floral meristem and at stage 3, expression is restricted to the L1 and L2 layers. Later on, expressed in the gynoecium and stamen primordia at stage 6. {ECO:0000269\|PubMed:25636918}.
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). Expressed in lateral root cap, root epidermis, root endodermis, columella of the root meristematic region, the vascular cylinder in differentiated zones of the primary root and in emerged lateral root primordia (PubMed:24121311). Expressed in pollen (PubMed:12949148). {ECO:0000269\|PubMed:12949148, ECO:0000269\|PubMed:24121311, ECO:0000269\|PubMed:7549482}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020875883.1	2e-36	agamous-like MADS-box protein AGL14 isoform X4
Swissprot	Q38838	9e-37	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	V4T0S3	1e-48	V4T0S3_9ROSI; Uncharacterized protein
STRING	XP_006440498.1	2e-49	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	4e-39	AGAMOUS-like 14

Link Out ? help Back to Top
Phytozome	Ciclev10023160m
Entrez Gene	18047163

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]