![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_17149 | ||||||||
Common Name | KK1_017658 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 94aa MW: 10907 Da PI: 10.7694 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.8 | 5.1e-27 | 12 | 62 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n rqvtfskRr+g++KKA+ELS+LCdae+a+i+fs t kl+ey+s C.cajan_17149 12 KKIDNINARQVTFSKRRKGLFKKAQELSTLCDAEIALIVFSATSKLFEYAS 62 689**********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 1.83E-27 | 4 | 65 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.1E-37 | 4 | 63 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.511 | 4 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 6 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-26 | 6 | 26 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.9E-25 | 13 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-26 | 26 | 41 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-26 | 41 | 62 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MNRMARKKIP IKKIDNINAR QVTFSKRRKG LFKKAQELST LCDAEIALIV FSATSKLFEY 60 ASSRYIFPYK YLLLYLFLCV HVKAKLLTNV ANSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-19 | 4 | 63 | 1 | 60 | MEF2C |
5f28_B | 3e-19 | 4 | 63 | 1 | 60 | MEF2C |
5f28_C | 3e-19 | 4 | 63 | 1 | 60 | MEF2C |
5f28_D | 3e-19 | 4 | 63 | 1 | 60 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_17149 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 7e-66 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020220153.1 | 1e-34 | MADS-box protein JOINTLESS | ||||
Refseq | XP_029128385.1 | 1e-34 | MADS-box protein JOINTLESS | ||||
Swissprot | O82794 | 4e-28 | AGL24_ARATH; MADS-box protein AGL24 | ||||
TrEMBL | A0A151T7S1 | 3e-61 | A0A151T7S1_CAJCA; MADS-box protein JOINTLESS | ||||
STRING | GLYMA13G33051.1 | 3e-33 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 5e-22 | AGAMOUS-like 24 |