![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast08G114200.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 264aa MW: 30188.4 Da PI: 8.8546 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.1 | 4.1e-27 | 63 | 113 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien+snr+vtf+kRr+g+ KKA E+SvLCdaev v+ifss gkl++++s Brast08G114200.1.p 63 KRIENTSNRHVTFAKRRAGLVKKAREISVLCDAEVGVVIFSSAGKLHDFCS 113 79***********************************************96 PP | |||||||
2 | K-box | 71 | 3.5e-24 | 125 | 222 | 1 | 98 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 yq++sgk l+++k++s + e++++kke++n+q e+Rh++GedL+sL+ keL +e++L+++ ++ R+k++e+++++ ++ ++ e+e++ Brast08G114200.1.p 125 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQIELRHMKGEDLNSLQPKELIAIEEALQNGQTNLRDKQMEHWKMHRRNEKMLEDEHKLLA 215 79999999******************************************************************************99999 PP K-box 92 kaLrkkl 98 +++++ Brast08G114200.1.p 216 FRMHQQD 222 8888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.5E-39 | 55 | 114 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.721 | 55 | 115 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.42E-32 | 56 | 149 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.19E-40 | 56 | 134 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 57 | 111 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-27 | 57 | 77 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.5E-24 | 64 | 111 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-27 | 77 | 92 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-27 | 92 | 113 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.3E-16 | 136 | 218 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.048 | 138 | 224 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 264 aa Download sequence Send to blast |
MVSLTPTGHH KDPHHHSCSQ EPREGGGSRR RARSPGLGGL LVGVLLGDFS EEIEMGRGKI 60 EIKRIENTSN RHVTFAKRRA GLVKKAREIS VLCDAEVGVV IFSSAGKLHD FCSPKTTLPR 120 ILEKYQTNSG KILWDEKHKS ISAEIDRVKK ENDNMQIELR HMKGEDLNSL QPKELIAIEE 180 ALQNGQTNLR DKQMEHWKMH RRNEKMLEDE HKLLAFRMHQ QDAELSNGMR EMELGYHHGR 240 DFAPQMPFTF RVQPSHPNLQ EDK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-18 | 55 | 125 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00080 | ChIP-seq | Transfer from AT5G20240 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast08G114200.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF469311 | 0.0 | KF469311.1 Brachypodium distachyon MADS-box transcription factor 16 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003568421.1 | 1e-154 | MADS-box transcription factor 4-like isoform X2 | ||||
Swissprot | Q40703 | 1e-131 | MADS4_ORYSJ; MADS-box transcription factor 4 | ||||
TrEMBL | I1HJ94 | 1e-153 | I1HJ94_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G24940.2 | 1e-153 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3434 | 38 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 3e-77 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast08G114200.1.p |