| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | AP2 | 54.6 | 2.6e-17 | 78 | 128 | 1 | 55 |
AP2 1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
+ y+GVr++ + +Wv+e+r+p +k++r++lg++ tae+Aa+a++ a+++++g
Achn317201 78 PVYRGVRRRN-TDKWVCEVREP---NKKTRIWLGTYPTAEMAARAHDVAALAFKG 128
68*****887.9******9998...347**********************99887 PP
|
| 2 | AP2 | 28.4 | 4e-09 | 145 | 174 | 26 | 55 |
AP2 26 gkrkrfslgkfgtaeeAakaaiaarkkleg 55
+k++r++lg++ tae+Aa+a++ a+++l+g
Achn317201 145 NKKTRIWLGTYPTAEMAARAHDVAALALKG 174
3479***********************998 PP
|
| Publications
? help Back to Top |
- Keily J, et al.
Model selection reveals control of cold signalling by evening-phased components of the plant circadian clock.
Plant J., 2013. 76(2): p. 247-57
[PMID:23909712] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Shi H, et al.
The Cysteine2/Histidine2-Type Transcription Factor ZINC FINGER OF ARABIDOPSIS THALIANA6 Modulates Biotic and Abiotic Stress Responses by Activating Salicylic Acid-Related Genes and C-REPEAT-BINDING FACTOR Genes in Arabidopsis.
Plant Physiol., 2014. 165(3): p. 1367-1379
[PMID:24834923] - Oakley CG,Ågren J,Atchison RA,Schemske DW
QTL mapping of freezing tolerance: links to fitness and adaptive trade-offs.
Mol. Ecol., 2014. 23(17): p. 4304-15
[PMID:25039860] - Miyazaki Y,Abe H,Takase T,Kobayashi M,Kiyosue T
Overexpression of LOV KELCH protein 2 confers dehydration tolerance and is associated with enhanced expression of dehydration-inducible genes in Arabidopsis thaliana.
Plant Cell Rep., 2015. 34(5): p. 843-52
[PMID:25627253] - Park S, et al.
Regulation of the Arabidopsis CBF regulon by a complex low-temperature regulatory network.
Plant J., 2015. 82(2): p. 193-207
[PMID:25736223] - Sazegari S,Niazi A,Ahmadi FS
A study on the regulatory network with promoter analysis for Arabidopsis DREB-genes.
Bioinformation, 2015. 11(2): p. 101-6
[PMID:25848171] - Li Y,Xu B,Du Q,Zhang D
Transcript abundance patterns of Populus C-repeat binding factor2 orthologs and genetic association of PsCBF2 allelic variation with physiological and biochemical traits in response to abiotic stress.
Planta, 2015. 242(1): p. 295-312
[PMID:25916311] - Shi H,Qian Y,Tan DX,Reiter RJ,He C
Melatonin induces the transcripts of CBF/DREB1s and their involvement in both abiotic and biotic stresses in Arabidopsis.
J. Pineal Res., 2015. 59(3): p. 334-42
[PMID:26182834] - Wang CL,Zhang SC,Qi SD,Zheng CC,Wu CA
Delayed germination of Arabidopsis seeds under chilling stress by overexpressing an abiotic stress inducible GhTPS11.
Gene, 2016. 575(2 Pt 1): p. 206-12
[PMID:26325072] - Gehan MA, et al.
Natural variation in the C-repeat binding factor cold response pathway correlates with local adaptation of Arabidopsis ecotypes.
Plant J., 2015. 84(4): p. 682-93
[PMID:26369909] - Su F, et al.
Burkholderia phytofirmans PsJN reduces impact of freezing temperatures on photosynthesis in Arabidopsis thaliana.
Front Plant Sci, 2015. 6: p. 810
[PMID:26483823] - Chan Z, et al.
RDM4 modulates cold stress resistance in Arabidopsis partially through the CBF-mediated pathway.
New Phytol., 2016. 209(4): p. 1527-39
[PMID:26522658] - Wu J, et al.
Overexpression of Muscadinia rotundifolia CBF2 gene enhances biotic and abiotic stress tolerance in Arabidopsis.
Protoplasma, 2017. 254(1): p. 239-251
[PMID:26795343] - Gao S, et al.
A cotton miRNA is involved in regulation of plant response to salt stress.
Sci Rep, 2016. 6: p. 19736
[PMID:26813144] - Shi H,Wei Y,He C
Melatonin-induced CBF/DREB1s are essential for diurnal change of disease resistance and CCA1 expression in Arabidopsis.
Plant Physiol. Biochem., 2016. 100: p. 150-155
[PMID:26828406] - Norén L, et al.
Circadian and Plastid Signaling Pathways Are Integrated to Ensure Correct Expression of the CBF and COR Genes during Photoperiodic Growth.
Plant Physiol., 2016. 171(2): p. 1392-406
[PMID:27208227] - Zhao C, et al.
Mutational Evidence for the Critical Role of CBF Transcription Factors in Cold Acclimation in Arabidopsis.
Plant Physiol., 2016. 171(4): p. 2744-59
[PMID:27252305] - Jia Y, et al.
The cbfs triple mutants reveal the essential functions of CBFs in cold acclimation and allow the definition of CBF regulons in Arabidopsis.
New Phytol., 2016. 212(2): p. 345-53
[PMID:27353960] - Zhao C,Zhu JK
The broad roles of CBF genes: From development to abiotic stress.
Plant Signal Behav, 2016. 11(8): p. e1215794
[PMID:27472659] - Bolt S,Zuther E,Zintl S,Hincha DK,Schmülling T
ERF105 is a transcription factor gene of Arabidopsis thaliana required for freezing tolerance and cold acclimation.
Plant Cell Environ., 2017. 40(1): p. 108-120
[PMID:27723941] - Shi Y, et al.
The precise regulation of different COR genes by individual CBF transcription factors in Arabidopsis thaliana.
J Integr Plant Biol, 2017. 59(2): p. 118-133
[PMID:28009483] - Li H, et al.
BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis.
Mol Plant, 2017. 10(4): p. 545-559
[PMID:28089951] - Kidokoro S, et al.
Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
Plant Cell, 2017. 29(4): p. 760-774
[PMID:28351986] - Li A, et al.
Transcriptome Profiling Reveals the Negative Regulation of Multiple Plant Hormone Signaling Pathways Elicited by Overexpression of C-Repeat Binding Factors.
Front Plant Sci, 2017. 8: p. 1647
[PMID:28983312] - Cho S, et al.
Accession-Dependent CBF Gene Deletion by CRISPR/Cas System in Arabidopsis.
Front Plant Sci, 2017. 8: p. 1910
[PMID:29163623] - Beine-Golovchuk O, et al.
Plant Temperature Acclimation and Growth Rely on Cytosolic Ribosome Biogenesis Factor Homologs.
Plant Physiol., 2018. 176(3): p. 2251-2276
[PMID:29382692] - Park S,Gilmour SJ,Grumet R,Thomashow MF
CBF-dependent and CBF-independent regulatory pathways contribute to the differences in freezing tolerance and cold-regulated gene expression of two Arabidopsis ecotypes locally adapted to sites in Sweden and Italy.
PLoS ONE, 2018. 13(12): p. e0207723
[PMID:30517145]
|
