PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn002551 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 126aa MW: 14651 Da PI: 9.9536 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.8 | 9e-31 | 2 | 52 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++g+lye+ss Achn002551 2 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSNKGRLYEFSS 52 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 5.62E-27 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.74E-34 | 1 | 58 | No hit | No description |
PROSITE profile | PS50066 | 29.03 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-31 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-26 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.2E-19 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.2E-19 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MKRIENATSR QVTFSKRRNG LLKKAFELSV LCDAEVALII FSNKGRLYEF SSSRFLGIWH 60 LQDSEYRPLS VFSMVIQDQL FKEKIKQLKE ECEKQSRLLS TTLQVVHREI SDVNTELFIG 120 RPPER* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-15 | 1 | 53 | 8 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP407147 | 3e-84 | KP407147.1 Actinidia chinensis SOC1a (SOC1a) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A0F7LFL3 | 9e-30 | A0A0F7LFL3_ACTCH; SOC1a | ||||
TrEMBL | A0A2R6QK50 | 9e-30 | A0A2R6QK50_ACTCH; Agamous-like MADS-box protein | ||||
STRING | Lus10006716 | 3e-32 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 1e-29 | AGAMOUS-like 14 |