PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA18G00181 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 233aa MW: 26176.4 Da PI: 8.7115 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 76.4 | 3.7e-24 | 171 | 220 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kpr++W+ eLH++Fv av+qL ekA+Pk+ile+m+v+gLt+e+v+SHLQ AA18G00181 171 KPRVVWSVELHQQFVAAVNQL-SVEKAVPKKILEMMNVPGLTRENVASHLQ 220 79*******************.9**************************** PP | |||||||
2 | Response_reg | 84.6 | 2.9e-28 | 33 | 141 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 vl+vdD+p+ +++l+++l+ +y +v+ + +e al ll++++ +D+++ D+ mp+mdG++ll++i e +lp+i+++a ++++ +l+ + Ga AA18G00181 33 VLVVDDDPTSLMILEKMLRTCRY-RVTKCNRAEIALSLLRKNKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDSKSVVLKGVTHGAV 127 89*********************.***************999999**********************6654.8************************ PP EEEESS--HHHHHH CS Response_reg 96 dflsKpfdpeelvk 109 d+l Kp+ +e+l + AA18G00181 128 DYLIKPVRIEALKN 141 **********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:3.40.50.2300 | 1.0E-42 | 30 | 169 | No hit | No description |
SuperFamily | SSF52172 | 4.84E-37 | 30 | 162 | IPR011006 | CheY-like superfamily |
SMART | SM00448 | 2.2E-30 | 31 | 143 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 42.354 | 32 | 147 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 1.0E-24 | 33 | 141 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 1.39E-27 | 34 | 146 | No hit | No description |
SuperFamily | SSF46689 | 1.04E-15 | 168 | 221 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 170 | 220 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.8E-20 | 171 | 221 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 3.1E-6 | 173 | 221 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MMNPGLVRVP ESNSGRNLAG EVAPDQFPAG LRVLVVDDDP TSLMILEKML RTCRYRVTKC 60 NRAEIALSLL RKNKNGFDIV ISDVHMPDMD GFKLLEHIGL EMDLPVIMMS ADDSKSVVLK 120 GVTHGAVDYL IKPVRIEALK NIWQHVVRKK RNEWNVSEQR DDKEDASTLT KPRVVWSVEL 180 HQQFVAAVNQ LSVEKAVPKK ILEMMNVPGL TRENVASHLQ SVDDSKSVSK SKL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 3e-18 | 171 | 220 | 5 | 54 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA18G00181 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013671742.1 | 1e-126 | two-component response regulator ARR2 | ||||
Swissprot | Q9ZWJ9 | 1e-123 | ARR2_ARATH; Two-component response regulator ARR2 | ||||
TrEMBL | A0A0D3A7S0 | 1e-124 | A0A0D3A7S0_BRAOL; Two-component response regulator | ||||
STRING | Bo1g055180.1 | 1e-125 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2403 | 27 | 73 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16110.1 | 1e-125 | response regulator 2 |