PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678451635 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 138aa MW: 15866.1 Da PI: 9.9742 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.6 | 7.3e-15 | 23 | 80 | 3 | 60 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 e k+ rrk +NRe+ArrsR++++++++ L + v ++aeN + + e +k +a ++ 678451635 23 EKKKKRRKLSNRESARRSRLKRQQYVKDLNDQVVHFSAENGEIDAKCEDIKRRYAGVE 80 5699*************************************99999999998887655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.2E-15 | 21 | 85 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.335 | 23 | 86 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.7E-12 | 23 | 77 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.31E-10 | 25 | 75 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 5.2E-11 | 25 | 77 | No hit | No description |
CDD | cd14702 | 1.40E-13 | 26 | 77 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 28 | 43 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MAMLGSNSIS SEVYGHGAIT LDEKKKKRRK LSNRESARRS RLKRQQYVKD LNDQVVHFSA 60 ENGEIDAKCE DIKRRYAGVE LENGKLRKLG EELKGGCKCW RKLWIPISSH DSFLQELSIE 120 EPWHQIQPPF QSQGVAGR |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 22 | 30 | EKKKKRRKL |
2 | 23 | 28 | KKKKRR |
3 | 23 | 29 | KKKKRRK |
4 | 23 | 30 | KKKKRRKL |
5 | 24 | 28 | KKKRR |
6 | 24 | 29 | KKKRRK |
7 | 25 | 29 | KKRRK |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678451635 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA15128 | 7 | 8 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 2e-15 | G-box binding factor 6 |