![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462919713 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 200aa MW: 22173.4 Da PI: 9.6484 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.7 | 2.5e-33 | 109 | 167 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+ 462919713 109 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDQGVVVTTYEGTHTHP 167 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.6E-34 | 94 | 167 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.84E-30 | 101 | 168 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.182 | 104 | 169 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.4E-39 | 109 | 168 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.6E-27 | 110 | 167 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MEGNYSMLFA TQPSSSTANS YHFMAGTSSH DHDHHVTHVG HRSISHGSFL GDHPSSKDGV 60 SQTELGESSG GGGAGEADRS TGVVEKRKGG KKERRPRYAF QTRSQVDILD DGYRWRKYGQ 120 KAVKNNKFPR SYYRCTHQGC NVKKQVQRLS KDQGVVVTTY EGTHTHPIEK SNDNFEHILT 180 QMQIYSGIGG SGFSSSPMFQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 100 | 168 | 8 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 100 | 168 | 8 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462919713 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728200 | 8e-92 | KJ728200.1 Zea mays clone pUT6475 WRKY transcription factor (WRKY108) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004979296.1 | 2e-87 | probable WRKY transcription factor 75 | ||||
Refseq | XP_025826644.1 | 3e-87 | probable WRKY transcription factor 12 isoform X1 | ||||
Refseq | XP_025826645.1 | 2e-87 | probable WRKY transcription factor 75 isoform X2 | ||||
TrEMBL | A0A3B6APP7 | 2e-86 | A0A3B6APP7_WHEAT; Uncharacterized protein | ||||
STRING | Si026859m | 9e-87 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 1e-57 | WRKY DNA-binding protein 75 |