 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
29838.m001690 |
| Common Name | RCOM_0885720 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
| Family |
M-type_MADS |
| Protein Properties |
Length: 61aa MW: 7042.28 Da PI: 10.9484 |
| Description |
M-type_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| 29838.m001690 | genome | JCVI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 89.8 | 1.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl+ey+s
29838.m001690 9 KKIDNITARQVTFSKRRRGLFKKAYELSTLCDAEIALLVFSATGKLFEYAS 59
68***********************************************86 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0055114 | Biological Process | oxidation-reduction process |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0032440 | Molecular Function | 2-alkenal reductase [NAD(P)] activity |
| GO:0046983 | Molecular Function | protein dimerization activity |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | EU334633 | 1e-57 | EU334633.1 Euphorbia esula dormancy associated MADS-box protein (DAM1) gene, complete cds. |
| GenBank | JX966351 | 1e-57 | JX966351.1 Euphorbia esula clone BAC_DAM3 DAM3 (DAM3) gene, complete cds, alternatively spliced. |
| Publications
? help Back to Top |
- Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
PLoS ONE, 2013. 8(6): p. e67243
[PMID:23840638] - Lei HJ, et al.
Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
Gene, 2013. 531(2): p. 158-67
[PMID:24055423] - Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
BMC Plant Biol., 2015. 15: p. 41
[PMID:25848674] - Sacharowski SP, et al.
SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
Plant Cell, 2015. 27(7): p. 1889-906
[PMID:26106148] - Sun LM,Zhang JZ,Hu CG
Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.).
Front Plant Sci, 2016. 7: p. 823
[PMID:27375669]
|
