PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC7AG042530.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 46aa MW: 5246.9 Da PI: 7.4403 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 35.3 | 2.7e-11 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W++eEde+lv++++ +G g+W+ ++++ g TRIDC7AG042530.1 14 RGLWSPEEDEKLVRYITTHGYGCWSEVPEKAG 45 789*************************9987 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 46 aa Download sequence |
MGHHSCCNQQ KVKRGLWSPE EDEKLVRYIT THGYGCWSEV PEKAGA |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63910.1 | 5e-30 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC7AG042530.1 |