Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 54.3 | 3e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
AT1G63910.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
788*******************************************97 PP
|
2 | Myb_DNA-binding | 51.5 | 2.3e-16 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rgr+++eE++l++ ++ G++ W+ Ia++++ gRt++++k++w+++
AT1G63910.1 67 RGRFSPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
89********************.*********.************98 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter |
GO:0030154 | Biological Process | cell differentiation |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:1901430 | Biological Process | positive regulation of syringal lignin biosynthetic process |
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis |
GO:0005634 | Cellular Component | nucleus |
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding |
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl. Plant Physiol., 2005. 138(2): p. 803-18 [PMID:15923329] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Zhong R,Demura T,Ye ZH
SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis. Plant Cell, 2006. 18(11): p. 3158-70 [PMID:17114348] - Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana. Plant J., 2007. 50(6): p. 1035-48 [PMID:17565617] - Zhang ZB, et al.
Transcription factor AtMYB103 is required for anther development by regulating tapetum development, callose dissolution and exine formation in Arabidopsis. Plant J., 2007. 52(3): p. 528-38 [PMID:17727613] - Zhong R,Richardson EA,Ye ZH
The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis. Plant Cell, 2007. 19(9): p. 2776-92 [PMID:17890373] - Lasserre E,Jobet E,Llauro C,Delseny M
AtERF38 (At2g35700), an AP2/ERF family transcription factor gene from Arabidopsis thaliana, is expressed in specific cell types of roots, stems and seeds that undergo suberization. Plant Physiol. Biochem., 2008. 46(12): p. 1051-61 [PMID:18723362] - Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2763-82 [PMID:18952777] - Koizumi K,Yokoyama R,Nishitani K
Mechanical load induces upregulation of transcripts for a set of genes implicated in secondary wall formation in the supporting tissue of Arabidopsis thaliana. J. Plant Res., 2009. 122(6): p. 651-9 [PMID:19582540] - Phan HA,Iacuone S,Li SF,Parish RW
The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana. Plant Cell, 2011. 23(6): p. 2209-24 [PMID:21673079] - Phan HA,Li SF,Parish RW
MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops. Plant Mol. Biol., 2012. 78(1-2): p. 171-83 [PMID:22086333] - Hussey SG, et al.
SND2, a NAC transcription factor gene, regulates genes involved in secondary cell wall development in Arabidopsis fibres and increases fibre cell area in Eucalyptus. BMC Plant Biol., 2011. 11: p. 173 [PMID:22133261] MYB103 is required for FERULATE-5-HYDROXYLASE expression and syringyl lignin biosynthesis in Arabidopsis stems. Plant J., 2013. 73(1): p. 63-76 [PMID:22967312]
|