PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC7AG007440.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 55aa MW: 6376.31 Da PI: 4.5639 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 52 | 2.3e-16 | 11 | 55 | 1 | 46 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwd 46 +ppGfrFhPt+eel+++yL+kkv+ ++++l +vi++vd++k+ePwd TRIDC7AG007440.3 11 VPPGFRFHPTEEELLTYYLTKKVAPQRMDL-DVIRDVDLTKLEPWD 55 69****************************.9*************7 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 55 aa Download sequence |
MSISVNGQSV VPPGFRFHPT EEELLTYYLT KKVAPQRMDL DVIRDVDLTK LEPWD |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46770.1 | 2e-27 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC7AG007440.3 |