PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G46770.1
Common NameANAC043, EMB2301, F19D11.5, NAC043, NST1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 365aa    MW: 40780.7 Da    PI: 6.7507
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G46770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.16e-52161441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv++ +++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  AT2G46770.1  16 VPPGFRFHPTEEELLQYYLRKKVNSIEIDL-DVIRDVDLNKLEPWDIQEmcKIGTtPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS- 111
                  69****************************.99**************962433332455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  AT2G46770.1 112 NGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                  999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-5910180IPR003441NAC domain
PROSITE profilePS5100556.5616180IPR003441NAC domain
PfamPF023658.3E-2817144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000056anatomyflower bud
PO:0005848anatomysecondary xylem
PO:0006202anatomyinterfascicular region
PO:0009015anatomyportion of vascular tissue
PO:0009025anatomyvascular leaf
PO:0009052anatomyflower pedicel
PO:0009066anatomyanther
PO:0009067anatomyfilament
PO:0009074anatomystyle
PO:0020139anatomyleaf midvein
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MMSKSMSISV NGQSQVPPGF RFHPTEEELL QYYLRKKVNS IEIDLDVIRD VDLNKLEPWD  60
IQEMCKIGTT PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKIIY SNGRRIGMRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDNIIS PEDVTVHEVV SIIGEASQDE GWVVCRIFKK  180
KNLHKTLNSP VGGASLSGGG DTPKTTSSQI FNEDTLDQFL ELMGRSCKEE LNLDPFMKLP  240
NLESPNSQAI NNCHVSSPDT NHNIHVSNVV DTSFVTSWAA LDRLVASQLN GPTSYSITAV  300
NESHVGHDHL ALPSVRSPYP SLNRSASYHA GLTQEYTPEM ELWNTTTSSL SSSPGPFCHV  360
SNGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-481318214167NO APICAL MERISTEM PROTEIN
1ut4_B8e-481318214167NO APICAL MERISTEM PROTEIN
1ut7_A8e-481318214167NO APICAL MERISTEM PROTEIN
1ut7_B8e-481318214167NO APICAL MERISTEM PROTEIN
3swm_A1e-471318217170NAC domain-containing protein 19
3swm_B1e-471318217170NAC domain-containing protein 19
3swm_C1e-471318217170NAC domain-containing protein 19
3swm_D1e-471318217170NAC domain-containing protein 19
3swp_A1e-471318217170NAC domain-containing protein 19
3swp_B1e-471318217170NAC domain-containing protein 19
3swp_C1e-471318217170NAC domain-containing protein 19
3swp_D1e-471318217170NAC domain-containing protein 19
4dul_A8e-481318214167NAC domain-containing protein 19
4dul_B8e-481318214167NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266714_at0.0
Expression AtlasAT2G46770-
AtGenExpressAT2G46770-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}.
Functional Description ? help Back to Top
Source Description
TAIRNAC transcription factor NST1. NST1 and NST2 are redundant in regulating secondary wall thickening in anther walls and siliques. NST1 promoter was detected in various tissues in which lignified secondary walls develop.
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Function -- GeneRIF ? help Back to Top
  1. NST1 and NST3 redundantly regulate the secondary wall thickenings in interfascicular fiber of inflorescence stems and secondary xylem of hypocotyls in Arabidopsis without affecting the formation of cells destined to be woody tissues. [NST1]
    [PMID: 17237351]
  2. First line evidence demonstrating that SND1 and NST1 function redundantly in the regulation of secondary wall synthesis in fibers is presented.
    [PMID: 17333250]
  3. NST1 and NST3 regulate the formation of secondary walls in siliques which regulates pod shattering.
    [PMID: 18657234]
  4. These results demonstrate that NST2 together with SND1 and NST1 regulate secondary wall biosynthesis in fibers of stems.
    [PMID: 25751728]
  5. The MYB26 protein is localized specifically to the anther endothecium nuclei and that it directly regulates two NAC domain genes, NST1 and NST2, which are critical for the induction of secondary thickening biosynthesis genes.
    [PMID: 28724622]
  6. Genes controlling SCW formation were activated by the overexpression of LBD30, but not in the LBD30(K226R) mutant. LBD30 enhancement of SCW formation resulted from upregulation of SND1/NST1-mediated transcriptional networks. This study presents a mechanism by which sumoylation of LBD30, mediated by SIZ1, regulates SCW formation in A. thaliana.
    [PMID: 30657769]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G46770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G13890 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT4G33450(A), AT5G12870(A), AT5G56110(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G46770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0204130.0BT020413.1 Arabidopsis thaliana At2g46770 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182200.20.0NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
SwissprotQ84WP60.0NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A178VUZ50.0A0A178VUZ5_ARATH; NST1
STRINGAT2G46770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M
    The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence.
    Plant Cell, 2005. 17(11): p. 2993-3006
    [PMID:16214898]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Mitsuda N, et al.
    NAC transcription factors, NST1 and NST3, are key regulators of the formation of secondary walls in woody tissues of Arabidopsis.
    Plant Cell, 2007. 19(1): p. 270-80
    [PMID:17237351]
  8. Yang C, et al.
    Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.
    Plant Cell, 2007. 19(2): p. 534-48
    [PMID:17329564]
  9. Zhong R,Richardson EA,Ye ZH
    Two NAC domain transcription factors, SND1 and NST1, function redundantly in regulation of secondary wall synthesis in fibers of Arabidopsis.
    Planta, 2007. 225(6): p. 1603-11
    [PMID:17333250]
  10. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  11. Mitsuda N,Ohme-Takagi M
    NAC transcription factors NST1 and NST3 regulate pod shattering in a partially redundant manner by promoting secondary wall formation after the establishment of tissue identity.
    Plant J., 2008. 56(5): p. 768-78
    [PMID:18657234]
  12. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  13. Zhou J,Lee C,Zhong R,Ye ZH
    MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.
    Plant Cell, 2009. 21(1): p. 248-66
    [PMID:19122102]
  14. Iwase A,Hideno A,Watanabe K,Mitsuda N,Ohme-Takagi M
    A chimeric NST repressor has the potential to improve glucose productivity from plant cell walls.
    J. Biotechnol., 2009. 142(3-4): p. 279-84
    [PMID:19497342]
  15. McCarthy RL,Zhong R,Ye ZH
    MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2009. 50(11): p. 1950-64
    [PMID:19808805]
  16. Zhao Q, et al.
    Syringyl lignin biosynthesis is directly regulated by a secondary cell wall master switch.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(32): p. 14496-501
    [PMID:20660755]
  17. Zhong R,Lee C,Ye ZH
    Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis.
    Mol Plant, 2010. 3(6): p. 1087-103
    [PMID:20935069]
  18. Yamaguchi M, et al.
    VASCULAR-RELATED NAC-DOMAIN7 directly regulates the expression of a broad range of genes for xylem vessel formation.
    Plant J., 2011. 66(4): p. 579-90
    [PMID:21284754]
  19. McCarthy RL,Zhong R,Ye ZH
    Secondary wall NAC binding element (SNBE), a key cis-acting element required for target gene activation by secondary wall NAC master switches.
    Plant Signal Behav, 2011. 6(9): p. 1282-5
    [PMID:21847026]
  20. Wang H,Zhao Q,Chen F,Wang M,Dixon RA
    NAC domain function and transcriptional control of a secondary cell wall master switch.
    Plant J., 2011. 68(6): p. 1104-14
    [PMID:21883551]
  21. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]
  22. Yang F, et al.
    Engineering secondary cell wall deposition in plants.
    Plant Biotechnol. J., 2013. 11(3): p. 325-35
    [PMID:23140549]
  23. Matschi S, et al.
    Function of calcium-dependent protein kinase CPK28 of Arabidopsis thaliana in plant stem elongation and vascular development.
    Plant J., 2013. 73(6): p. 883-96
    [PMID:23252373]
  24. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  25. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  26. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  27. Zhong R,Ye ZH
    The Arabidopsis NAC transcription factor NST2 functions together with SND1 and NST1 to regulate secondary wall biosynthesis in fibers of inflorescence stems.
    Plant Signal Behav, 2015. 10(2): p. e989746
    [PMID:25751728]
  28. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  29. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  30. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  31. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]