PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6BG052030.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 349aa    MW: 38191.7 Da    PI: 4.3251
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6BG052030.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2082135356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  TRIDC6BG052030.3  82 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 135
                       5678*************************************************9 PP

2HD-ZIP_I/II129.21.7e-4181172192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktk lE+d+++Lk+++dal++++++L +++++L +++ 
  TRIDC6BG052030.3  81 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLERDFDRLKASFDALRADHDALLQDNHRLLSQVV 172
                       69*************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    
WSPAGSSSTR RAPATDRCSS WTVARAASPA RPACSIEPCL SDEGVRPVLG GMEEGRGVKR  60
PFFTSPDDML EEEYYDEQLP EKKRRLTPEQ VHLLERSFEE ENKLEPERKT ELARKLGLQP  120
RQVAVWFQNR RARWKTKTLE RDFDRLKASF DALRADHDAL LQDNHRLLSQ VVTLTEKMQD  180
KEAPEGSFGA AVDASEPEQA AAEAEAKTSL ADAEEQAAAA EAFEVVQQQQ QLHVKDEERL  240
SPGSGGSAVL DARDALLGSG CGLAGVVDSS VDSYCFPGGA GGDEYHECVM GPVAGGIQSE  300
EDDGAGSDEG CSYYPDDAAV FFAAAQGHSH HHTDDDDQDD GQISYWMWN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.18e-56HD-ZIP family protein