Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 64.1 | 1.9e-20 | 68 | 121 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
k++++t+eq++ Le+ Fe ++++ e++++LAkklgL+ rqV vWFqNrRa++k
AT3G01470.1 68 KKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 121
56789************************************************9 PP
|
2 | HD-ZIP_I/II | 133.9 | 5.6e-43 | 67 | 159 | 1 | 93 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
ekkrrl++eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++ ++++Lr+e+++
AT3G01470.1 67 EKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTS 159
69**************************************************************************************99975 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Johannesson H,Wang Y,Engström P
DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol., 2001. 45(1): p. 63-73 [PMID:11247607] - Schena M,Davis RW
HD-Zip proteins: members of an Arabidopsis homeodomain protein superfamily. Proc. Natl. Acad. Sci. U.S.A., 1992. 89(9): p. 3894-8 [PMID:1349174] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Henriksson E, et al.
Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] - Ruberti I,Sessa G,Lucchetti S,Morelli G
A novel class of plant proteins containing a homeodomain with a closely linked leucine zipper motif. EMBO J., 1991. 10(7): p. 1787-91 [PMID:1675603] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Vrebalov J, et al.
Fleshy fruit expansion and ripening are regulated by the Tomato SHATTERPROOF gene TAGL1. Plant Cell, 2009. 21(10): p. 3041-62 [PMID:19880793] - Itkin M, et al.
TOMATO AGAMOUS-LIKE 1 is a component of the fruit ripening regulatory network. Plant J., 2009. 60(6): p. 1081-95 [PMID:19891701] - Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana. Protoplasma, 2010. 241(1-4): p. 29-36 [PMID:20101514] - Ariel F, et al.
Environmental regulation of lateral root emergence in Medicago truncatula requires the HD-Zip I transcription factor HB1. Plant Cell, 2010. 22(7): p. 2171-83 [PMID:20675575] - Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] - Zhang Y, et al.
Over-expression of WOX1 leads to defects in meristem development and polyamine homeostasis in Arabidopsis. J Integr Plant Biol, 2011. 53(6): p. 493-506 [PMID:21658178] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Capella M,R
Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB. Plant Cell Rep., 2014. 33(6): p. 955-67 [PMID:24531799] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Capella M,Ribone PA,Arce AL,Chan RL
Arabidopsis thaliana HomeoBox 1 (AtHB1), a Homedomain-Leucine Zipper I (HD-Zip I) transcription factor, is regulated by PHYTOCHROME-INTERACTING FACTOR 1 to promote hypocotyl elongation. New Phytol., 2015. 207(3): p. 669-82 [PMID:25865500] - Ribone PA,Capella M,Arce AL,Chan RL
A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype. Plant Physiol., 2017. 175(3): p. 1238-1253 [PMID:28956754] - Schena M,Davis RW
Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families. Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7 [PMID:7915839] - Sessa G,Morelli G,Ruberti I
The Athb-1 and -2 HD-Zip domains homodimerize forming complexes of different DNA binding specificities. EMBO J., 1993. 12(9): p. 3507-17 [PMID:8253077] - Aoyama T, et al.
Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco. Plant Cell, 1995. 7(11): p. 1773-85 [PMID:8535134] - Sessa G,Morelli G,Ruberti I
DNA-binding specificity of the homeodomain-leucine zipper domain. J. Mol. Biol., 1997. 274(3): p. 303-9 [PMID:9405140]
|