PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G01470.1

Common Name

ATHB1, ATHB-1, F4P13.2, HAT5, HB-1, HD-ZIP-1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 272aa MW: 30933.1 Da PI: 4.5368

Description

homeobox 1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G01470.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	64.1	1.9e-20	68	121	3	56
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k++++t+eq++ Le+ Fe ++++ e++++LAkklgL+ rqV vWFqNrRa++k AT3G01470.1 68 KKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 121 56789************************************************9 PP
2	HD-ZIP_I/II	133.9	5.6e-43	67	159	1	93
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 ekkrrl++eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++ ++++Lr+e+++ AT3G01470.1 67 EKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTS 159 69**************************************************************************************99975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.29E-20	54	125	IPR009057	Homeodomain-like
PROSITE profile	PS50071	18.01	63	123	IPR001356	Homeobox domain
SMART	SM00389	1.6E-19	66	127	IPR001356	Homeobox domain
Pfam	PF00046	1.7E-17	68	121	IPR001356	Homeobox domain
CDD	cd00086	8.91E-19	68	124	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.5E-22	69	130	IPR009057	Homeodomain-like
PRINTS	PR00031	4.0E-6	94	103	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	98	121	IPR017970	Homeobox, conserved site
PRINTS	PR00031	4.0E-6	103	119	IPR000047	Helix-turn-helix motif
Pfam	PF02183	1.3E-16	123	165	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001558	Biological Process	regulation of cell growth
GO:0009637	Biological Process	response to blue light
GO:0009651	Biological Process	response to salt stress
GO:0009965	Biological Process	leaf morphogenesis
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009001	anatomy	fruit
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem

Sequence ? help Back to Top
Protein Sequence Length: 272 aa Download sequence Send to blast
MESNSFFFDP SASHGNSMFF LGNLNPVVQG GGARSMMNME ETSKRRPFFS SPEDLYDDDF 60 YDDQLPEKKR RLTTEQVHLL EKSFETENKL EPERKTQLAK KLGLQPRQVA VWFQNRRARW 120 KTKQLERDYD LLKSTYDQLL SNYDSIVMDN DKLRSEVTSL TEKLQGKQET ANEPPGQVPE 180 PNQLDPVYIN AAAIKTEDRL SSGSVGSAVL DDDAPQLLDS CDSYFPSIVP IQDNSNASDH 240 DNDRSCFADV FVPTTSPSHD HHGESLAFWG WP

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	115	123	RRARWKTKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.47815	0.0	floral meristem\| leaf\| root\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186509659	0.0
Genevisible	259165_at	0.0
Expression Atlas	AT3G01470	-
AtGenExpress	AT3G01470	-
ATTED-II	AT3G01470	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed. {ECO:0000269\|PubMed:16055682}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a homeodomain leucine zipper class I (HD-Zip I) transcriptional activator involved in leaf development.
UniProt	Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269\|PubMed:8535134}.

Function -- GeneRIF ? help Back to Top
AtHB1 was highly expressed throughout in pavement, basal and trichome cells. [PMID: 20101514] The results suggest that AtHB1 acts downstream of PIF1 to promote hypocotyl elongation, especially in response to short-day photoperiods. [PMID: 25865500] The uncontrolled expression of AtHB1 is deleterious for the plant and, hence, finely repressed by a translational mechanism. [PMID: 28956754]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00323	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G01470.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G07900(R), AT2G19590(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G01470

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G01470

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY058188	0.0	AY058188.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBank	AY098972	0.0	AY098972.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBank	X58821	0.0	X58821.1 A.thaliana homeobox gene Athb-1 mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_186796.1	0.0	homeobox 1
Swissprot	Q02283	0.0	HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBL	A0A178VBZ2	0.0	A0A178VBZ2_ARATH; HD-ZIP-1
STRING	AT3G01470.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM8884	27	38
Representative plant	OGRP129	16	189

Link Out ? help Back to Top
Phytozome	AT3G01470.1
Entrez Gene	821138
iHOP	AT3G01470
wikigenes	AT3G01470

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Johannesson H,Wang Y,Engström P DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol., 2001. 45(1): p. 63-73 [PMID:11247607] Schena M,Davis RW HD-Zip proteins: members of an Arabidopsis homeodomain protein superfamily. Proc. Natl. Acad. Sci. U.S.A., 1992. 89(9): p. 3894-8 [PMID:1349174] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Ruberti I,Sessa G,Lucchetti S,Morelli G A novel class of plant proteins containing a homeodomain with a closely linked leucine zipper motif. EMBO J., 1991. 10(7): p. 1787-91 [PMID:1675603] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Vrebalov J, et al. Fleshy fruit expansion and ripening are regulated by the Tomato SHATTERPROOF gene TAGL1. Plant Cell, 2009. 21(10): p. 3041-62 [PMID:19880793] Itkin M, et al. TOMATO AGAMOUS-LIKE 1 is a component of the fruit ripening regulatory network. Plant J., 2009. 60(6): p. 1081-95 [PMID:19891701] Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana. Protoplasma, 2010. 241(1-4): p. 29-36 [PMID:20101514] Ariel F, et al. Environmental regulation of lateral root emergence in Medicago truncatula requires the HD-Zip I transcription factor HB1. Plant Cell, 2010. 22(7): p. 2171-83 [PMID:20675575] Shin R,Jez JM,Basra A,Zhang B,Schachtman DP 14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] Zhang Y, et al. Over-expression of WOX1 leads to defects in meristem development and polyamine homeostasis in Arabidopsis. J Integr Plant Biol, 2011. 53(6): p. 493-506 [PMID:21658178] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Capella M,R Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB. Plant Cell Rep., 2014. 33(6): p. 955-67 [PMID:24531799] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Capella M,Ribone PA,Arce AL,Chan RL Arabidopsis thaliana HomeoBox 1 (AtHB1), a Homedomain-Leucine Zipper I (HD-Zip I) transcription factor, is regulated by PHYTOCHROME-INTERACTING FACTOR 1 to promote hypocotyl elongation. New Phytol., 2015. 207(3): p. 669-82 [PMID:25865500] Ribone PA,Capella M,Arce AL,Chan RL A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype. Plant Physiol., 2017. 175(3): p. 1238-1253 [PMID:28956754] Schena M,Davis RW Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families. Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7 [PMID:7915839] Sessa G,Morelli G,Ruberti I The Athb-1 and -2 HD-Zip domains homodimerize forming complexes of different DNA binding specificities. EMBO J., 1993. 12(9): p. 3507-17 [PMID:8253077] Aoyama T, et al. Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco. Plant Cell, 1995. 7(11): p. 1773-85 [PMID:8535134] Sessa G,Morelli G,Ruberti I DNA-binding specificity of the homeodomain-leucine zipper domain. J. Mol. Biol., 1997. 274(3): p. 303-9 [PMID:9405140]