PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC6AG044320.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 205aa    MW: 22213.6 Da    PI: 4.6584
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC6AG044320.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-183481156
                      HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      q++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  TRIDC6AG044320.4  3 QVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 48
                      999******************************************9 PP

2HD-ZIP_I/II1192.5e-383851092
       HD-ZIP_I/II 10 qvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
                      qv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktk lE+d+++Lk+++dal++++++L +++++Lr+++ 
  TRIDC6AG044320.4  3 QVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLERDFDRLKASFDALRADHDALLQDNHRLRSQVV 85
                      9******************************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    
RVQVHLLERS FEEENKLEPE RKTELARKLG LQPRQVAVWF QNRRARWKTK TLERDFDRLK  60
ASFDALRADH DALLQDNHRL RSQVVTLTEK MQDKEAPEGS FGAAADASEP EQAAAEAKAS  120
LADAEEQAAA AEAFEVVQQQ LHVKDEERLS PGSGGSAVLD ARDALLGSGC GLAGVVDSSV  180
DSYCFPGGAG GDEYHECVVG PVAGG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.16e-46HD-ZIP family protein