PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC5AG038950.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 249aa    MW: 26654.3 Da    PI: 4.3963
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC5AG038950.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-193285356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  TRIDC5AG038950.4 32 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 85
                      45689************************************************9 PP

2HD-ZIP_I/II133.38.6e-4331123193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L++++e+L +e+++
  TRIDC5AG038950.4  31 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYNALRHSYDALRVDHDALRRDKEALLAEVRA 123
                       69*************************************************************************************999875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    
MYGVVGMEAD GDAEEEMMAC GGGGGGCGGG EKKRRLSAEQ VRALERSFEV ENKLEPERKA  60
RLARDLGLQP RQVAVWFQNR RARWKTKQLE RDYNALRHSY DALRVDHDAL RRDKEALLAE  120
VRAAHGKLGD EEAAASFTSV KEEPAASDGP PPAGMGSSDS DSSGVLNDTD ATGATPTEEA  180
PAPDMGTLLG GPGAAGAAAA GHGQVFLHGN FLKVEEDETG FLDDEEPCGG FFADEPPLAW  240
WTEPTDPWK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15763ERKARLA
28088RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-42HD-ZIP family protein