PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G40060.1 | ||||||||
Common Name | ATHB16, ATHB-16, HB16, T5J17.230 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 294aa MW: 33394.6 Da PI: 4.8839 | ||||||||
Description | homeobox protein 16 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.4 | 1.2e-18 | 59 | 112 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ +q+++Le+ Fe ++++ e++++LA++lgL+ rqV vWFqNrRa++k AT4G40060.1 59 KKRRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWK 112 5568999**********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 128.9 | 2.1e-41 | 58 | 150 | 1 | 93 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 ekkrrl+ +qvk+LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlEkdy +Lk +yd+l+++ ++L++++++L +e+++ AT4G40060.1 58 EKKRRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKGQYDSLRHNFDSLRRDNDSLLQEISK 150 69*************************************************************************************999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.17E-18 | 51 | 116 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.86 | 54 | 114 | IPR001356 | Homeobox domain |
SMART | SM00389 | 4.3E-17 | 57 | 118 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.82E-16 | 59 | 115 | No hit | No description |
Pfam | PF00046 | 7.1E-16 | 59 | 112 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-20 | 61 | 121 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 6.7E-6 | 85 | 94 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 89 | 112 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 6.7E-6 | 94 | 110 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 2.1E-16 | 114 | 155 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009637 | Biological Process | response to blue light | ||||
GO:0030308 | Biological Process | negative regulation of cell growth | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 294 aa Download sequence Send to blast |
MKRLSSSDSM CGLISTSTDE QSPRGYGSNY QSMLEGYDED ATLIEEYSGN HHHMGLSEKK 60 RRLKVDQVKA LEKNFELENK LEPERKTKLA QELGLQPRQV AVWFQNRRAR WKTKQLEKDY 120 GVLKGQYDSL RHNFDSLRRD NDSLLQEISK IKAKVNGEED NNNNKAITEG VKEEEVHKTD 180 SIPSSPLQFL EHSSGFNYRR SFTDLRDLLP NSTVVEAGSS DSCDSSAVLN DETSSDNGRL 240 TPPVTVTGGS FLQFVKTEQT EDHEDFLSGE EACGFFSDEQ PPSLHWYSAS DHWT |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 58 | 63 | KKRRLK |
2 | 106 | 114 | RRARWKTKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.20863 | 0.0 | bud| flower| root| silique| vegetative tissue |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30692590 | 0.0 | ||||
Genevisible | 252829_at | 0.0 | ||||
Expression Atlas | AT4G40060 | - | ||||
AtGenExpress | AT4G40060 | - | ||||
ATTED-II | AT4G40060 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with a lower level in siliques. {ECO:0000269|PubMed:16055682}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a homeodomain leucine zipper class I (HD-Zip I) protein. | |||||
UniProt | Probable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269|PubMed:14623244}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00051 | PBM | 25215497 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G40060.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G65310 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G40060 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF370620 | 0.0 | AF370620.1 Arabidopsis thaliana homeodomain-like protein (T5J17.230) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195716.1 | 0.0 | homeobox protein 16 | ||||
Swissprot | Q940J1 | 0.0 | ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16 | ||||
TrEMBL | A0A178V0P3 | 0.0 | A0A178V0P3_ARATH; HB16 | ||||
STRING | AT4G40060.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM545 | 28 | 143 | Representative plant | OGRP129 | 16 | 189 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G40060.1 |
Entrez Gene | 830169 |
iHOP | AT4G40060 |
wikigenes | AT4G40060 |