PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG056280.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 300aa    MW: 32739.1 Da    PI: 4.5443
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG056280.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-1954105556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  TRIDC4AG056280.4  54 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 105
                       467789*********************************************9 PP

2HD-ZIP_I/II1291.9e-4152143293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  TRIDC4AG056280.4  52 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAAEIHE 143
                       9**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    
LRRAIGIGEK LAFAEKENLL AAYMEHDEPE LEEADEEEEE EERAMSCGLG GKKRRLALEQ  60
VRALERSFET DNKLDPERKA RIARDLGLHP RQVAVWFQNR RARWKTKQLE RDFNALRARH  120
DALRADCDAL RRDKDALAAE IHELREKLST KPETSVKAEA AGNADAAEER LQQATMIGAA  180
VCKDGSSDSD SSAVFNDEAS PYSGAVFEQQ GFMGFGASFL DSASAAAATT GGGCSSLPML  240
EPKWPGAYPY DAGRSGGYGF TEEWLAGSDA IGNDGSAAFF SEEHVSNLNF GWCSSGAEGF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-30HD-ZIP family protein