PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC4AG023960.8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 40aa MW: 4441.16 Da PI: 4.3222 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 24.2 | 7.1e-08 | 1 | 35 | 30 | 64 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswl 64 ++adedv +i+ +Pvl+s+a elf+ +l s+ TRIDC4AG023960.8 1 MQADEDVGKIALAVPVLVSRALELFLQDLIDHSYK 35 89**************************9877765 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 40 aa Download sequence |
MQADEDVGKI ALAVPVLVSR ALELFLQDLI DHSYKITLQS |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 2e-17 | NF-YC family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC4AG023960.8 |