PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G12480.1 | ||||||||
Common Name | NF-YC11 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 293aa MW: 32291.7 Da PI: 4.8618 | ||||||||
Description | nuclear factor Y, subunit C11 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 58.4 | 1.6e-18 | 6 | 86 | 18 | 98 |
NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 ++++P arikki++adedv +i+ +Pvl+sk+ elf+ +l r++ + e +t+ ++ +v+r ++fdfl ++v + AT3G12480.1 6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTVSSLHLKHCVERYNVFDFLREVVSK 86 5789************************************************************************99976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-25 | 3 | 72 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.37E-19 | 4 | 88 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-19 | 8 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000005 | anatomy | cultured plant cell | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 293 aa Download sequence Send to blast |
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKSLE LFLQDLCDRT YEITLERGAK 60 TVSSLHLKHC VERYNVFDFL REVVSKVPDY GHSQGQGHGD VTMDDRSISK RRKPISDEVN 120 DSDEEYKKSK TQEIGSAKTS GRGGRGRGRG RGRGGRAAKA AEREGLNREM EVEAANSGQP 180 PPEDNVKMHA SESSPQEDEK KGIDGTAASN EDTKQHLQSP KEGIDFDLNA ESLDLNETKL 240 APATGTTTTT TAATDSEEYS GWPMMDISKM DPAQLASLGK RIDEDEEDYD EEG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 7e-23 | 2 | 72 | 5 | 75 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 144 | 153 | RGRGRGRGRG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.48650 | 0.0 | flower| root| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145338417 | 0.0 | ||||
Genevisible | 256258_at | 0.0 | ||||
Expression Atlas | AT3G12480 | - | ||||
AtGenExpress | AT3G12480 | - | ||||
ATTED-II | AT3G12480 | - |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G12480.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT4G14540, AT5G08190, AT5G47640, AT1G21970 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G12480 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF462841 | 0.0 | AF462841.1 Arabidopsis thaliana At3g12480/MQC3.32 mRNA, complete cds. | |||
GenBank | AY143847 | 0.0 | AY143847.1 Arabidopsis thaliana At3g12480/MQC3.32 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_187854.2 | 0.0 | nuclear factor Y, subunit C11 | ||||
TrEMBL | A0A384KK08 | 0.0 | A0A384KK08_ARATH; NF-YC11 | ||||
TrEMBL | Q9LHG0 | 0.0 | Q9LHG0_ARATH; At3g12480/MQC3.32 | ||||
STRING | AT3G12480.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3506 | 24 | 58 | Representative plant | OGRP2179 | 16 | 35 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G12480.1 |
Entrez Gene | 820427 |
iHOP | AT3G12480 |
wikigenes | AT3G12480 |