PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG009990.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 208aa    MW: 22821.5 Da    PI: 10.8194
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG009990.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind303.11e-92420692301
         GAGA_bind  92 asalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad 184
                       ++++p+g +++++++ +++lq+     ++++  +++eeek+  +  +e+++++  k+ +kkrq++++pk +k kk+kk  +++ ++ +++   
  TRIDC4AG009990.4   4 VHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEEEKIAPPL-VEEHSVVGSKPPVKKRQQGRQPKLPKPKKPKK-VATPGEDGAPKARA 89 
                       5899*****************9.....667777777888766555.556777788888888*****************.55666777777777 PP

         GAGA_bind 185 erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGy 277
                       +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy
  TRIDC4AG009990.4  90 PRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGY 182
                       9******************************************************************************************** PP

         GAGA_bind 278 dlsnpvDLkdhWAkHGtnkfvtir 301
                       +l+np+DLk++WAkHGtnkfvtir
  TRIDC4AG009990.4 183 NLNNPIDLKTFWAKHGTNKFVTIR 206
                       ***********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    
GHAVHHHPTG FGMMPDARGA HTLQMMQPQE PPVPEEEKIA PPLVEEHSVV GSKPPVKKRQ  60
QGRQPKLPKP KKPKKVATPG EDGAPKARAP RSRGPLKPVE MVINGIDFDI SRIPTPVCSC  120
TGAPQQCYRW GAGGWQSACC TTSISTYPLP MNTKRRGARI AGRKMSQGAF KKVLEKLAGE  180
GYNLNNPIDL KTFWAKHGTN KFVTIRRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17076PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.17e-65BBR-BPC family protein