PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG009990.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 395aa    MW: 43913.7 Da    PI: 10.0235
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG009990.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3491.1e-106483951301
         GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia..erdaki.......rernlalsekkaavaerd..................maflqrdk 65 
                       mdddgs + rn+g+ye     k nlglqlm s+a   rd+k+        +++ a +++ +++++rd                  m+f+++++
  TRIDC4AG009990.3  48 MDDDGSLSiRNWGFYETM---KGNLGLQLMPSVAggHRDTKPllpngtfLQHHNAPHHPPHSHHPRDygngepsggmpteppaihMDFVRNEA 137
                       9**************965...*************999*****999999955555699999********************************* PP

         GAGA_bind  66 alaernkalverdnkllalllvensla.............................salpvgvqvlsgtksidslqqlsepqledsavelree 129
                       +++  ++++ ++++   +++++++ +                              +++p+g +++++++ +++lq+     ++++  +++ee
  TRIDC4AG009990.3 138 WMHPSQHQHQQQHQHHHQNQHQQQHQHqhqhsreqkvlhavplgpaghighpghavHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEE 225
                       **983333333333333232222222223455789999999999999999999999999999999999999999999.....66667777788 PP

         GAGA_bind 130 eklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqC 222
                       ek+  +  +e+++++  k+ +kkrq++++pk +k kk+kk  +++ ++ +++   +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qC
  TRIDC4AG009990.3 226 EKIAPPL-VEEHSVVGSKPPVKKRQQGRQPKLPKPKKPKK-VATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQC 316
                       8766555.556777788888888*****************.556667777777779************************************* PP

         GAGA_bind 223 YkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       Y+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  TRIDC4AG009990.3 317 YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 395
                       ******************************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    
GFEGPRDWRL ECNGGYSLTV QSPKEEHISR SNLGFLGFRF VCSGPAEMDD DGSLSIRNWG  60
FYETMKGNLG LQLMPSVAGG HRDTKPLLPN GTFLQHHNAP HHPPHSHHPR DYGNGEPSGG  120
MPTEPPAIHM DFVRNEAWMH PSQHQHQQQH QHHHQNQHQQ QHQHQHQHSR EQKVLHAVPL  180
GPAGHIGHPG HAVHHHPTGF GMMPDARGAH TLQMMQPQEP PVPEEEKIAP PLVEEHSVVG  240
SKPPVKKRQQ GRQPKLPKPK KPKKVATPGE DGAPKARAPR SRGPLKPVEM VINGIDFDIS  300
RIPTPVCSCT GAPQQCYRWG AGGWQSACCT TSISTYPLPM NTKRRGARIA GRKMSQGAFK  360
KVLEKLAGEG YNLNNPIDLK TFWAKHGTNK FVTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259265PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.14e-62BBR-BPC family protein