PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG039040.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 248aa    MW: 27324.2 Da    PI: 9.5165
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG039040.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.8e-19105158356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+ +++keq + Lee F+ n+++s +++e LA kl+L  rqV vWFqNrRa+ k
  TRIDC3BG039040.2 105 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRARTK 158
                       67789***********************************************98 PP

2HD-ZIP_I/II119.32.1e-38105192289
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+k++E+++e+Lkr++ +l+een+rL++eveeLr+
  TRIDC3BG039040.2 105 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKHTEMECEYLKRCFGSLTEENRRLQREVEELRA 192
                       9*************************************************************************************94 PP

Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    
LGLGLLLSSS SSPFPCSCFR IGLSPVMGAT SPSGLELTMA VPGLSSSSGS EGFVCNNNIS  60
NNGGGNMRGL DMNQPASGGE EEDFLMGGVE EDEEERGAGG PHRPKKLRLS KEQSRLLEES  120
FRLNHTLSPK QKEALAIKLK LRPRQVEVWF QNRRARTKLK HTEMECEYLK RCFGSLTEEN  180
RRLQREVEEL RAMRMAPPTV LSPHTRQPLP ASALTMCPRC ERVTAATGPR ITRPPASPFH  240
PRRPSAAF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.11e-63HD-ZIP family protein