PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G01430.1

Common Name

ATHB17, ATHB-17, F2I9.5, HB17

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 275aa MW: 31689.5 Da PI: 9.481

Description

homeobox-leucine zipper protein 17

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G01430.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	56.3	5.5e-18	138	192	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ ++t+eq + Le+ F++n++++ +++e LAk+l L rq+ vWFqNrRa+ k AT2G01430.1 138 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSK 192 78889************************************************98 PP
2	HD-ZIP_I/II	117.5	7.7e-38	138	226	1	89
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 +kk+rl++eq++lLE+sF+++++L+p++K+ la++L l+prq++vWFqnrRAR k+kq+E+++e+Lkr++ +l+een+rL++eveeLr+ AT2G01430.1 138 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREVEELRA 226 69*************************************************************************************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.7E-17	119	192	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.71E-18	124	195	IPR009057	Homeodomain-like
PROSITE profile	PS50071	16.941	134	194	IPR001356	Homeobox domain
SMART	SM00389	5.7E-17	136	198	IPR001356	Homeobox domain
CDD	cd00086	5.33E-16	137	195	No hit	No description
Pfam	PF00046	2.8E-15	138	192	IPR001356	Homeobox domain
PROSITE pattern	PS00027	0	169	192	IPR017970	Homeobox, conserved site
SMART	SM00340	4.5E-23	194	237	IPR003106	Leucine zipper, homeobox-associated
Pfam	PF02183	7.5E-10	194	228	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 275 aa Download sequence Send to blast
MIKLLFTYIC TYTYKLYALY HMDYACVCMY KYKGIVTLQV CLFYIKLRVF LSNFTFSSSI 60 LALKNPNNSL IKIMAILPEN SSNLDLTISV PGFSSSPLSD EGSGGGRDQL RLDMNRLPSS 120 EDGDDEEFSH DDGSAPPRKK LRLTREQSRL LEDSFRQNHT LNPKQKEVLA KHLMLRPRQI 180 EVWFQNRRAR SKLKQTEMEC EYLKRWFGSL TEENHRLHRE VEELRAMKVG PTTVNSASSL 240 TMCPRCERVT PAASPSRAVV PVPAKKTFPP QERDR

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	186	194	RRARSKLKQ

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	266346_at	0.0
Expression Atlas	AT2G01430	-
AtGenExpress	AT2G01430	-
ATTED-II	AT2G01430	-

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
Results show that ATHB17 is involved in abscisic acid ABA and water-stress responses. Also, the ATHB17 effect on seedling growth in the presence of ABA was observed only during the postgermination seedling. [PMID: 23456334] This study reports the results of a functional genomics research effort that identified ATHB17, a transcription factor from the homeodomain-leucine zipper class II family, as a novel target for the enhancement of photosynthetic capacity. [PMID: 24006420] Expression of ATHB17Delta113 in maize leads to increased ear size at silking [PMID: 24736658] ATHB17 can positively modulate the expression of many plastid encoded genes (PEGs) through regulation of ATSIG5 by binding to their promoters. [PMID: 28358040]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G01430.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G01430

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G01430

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ431181	0.0	AJ431181.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper (Athb17 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_178252.2	0.0	homeobox-leucine zipper protein 17
Swissprot	Q8S9N6	0.0	ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBL	A0A178VTG1	1e-142	A0A178VTG1_ARATH; HB17
STRING	AT2G01430.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4890	27	47
Representative plant	OGRP196	16	156

Link Out ? help Back to Top
Phytozome	AT2G01430.1
Entrez Gene	814671
iHOP	AT2G01430
wikigenes	AT2G01430

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Oh S,Park S,Han KH Transcriptional regulation of secondary growth in Arabidopsis thaliana. J. Exp. Bot., 2003. 54(393): p. 2709-22 [PMID:14585825] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Lall S,Nettleton D,DeCook R,Che P,Howell SH Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis. Genetics, 2004. 167(4): p. 1883-92 [PMID:15342526] Nawy T, et al. Transcriptional profile of the Arabidopsis root quiescent center. Plant Cell, 2005. 17(7): p. 1908-25 [PMID:15937229] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Fleury D, et al. The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth. Plant Cell, 2007. 19(2): p. 417-32 [PMID:17329565] Park MY,Kim SA,Lee SJ,Kim SY ATHB17 is a positive regulator of abscisic acid response during early seedling growth. Mol. Cells, 2013. 35(2): p. 125-33 [PMID:23456334] Hymus GJ, et al. Application of HB17, an Arabidopsis class II homeodomain-leucine zipper transcription factor, to regulate chloroplast number and photosynthetic capacity. J. Exp. Bot., 2013. 64(14): p. 4479-90 [PMID:24006420] Rice EA, et al. Expression of a truncated ATHB17 protein in maize increases ear weight at silking. PLoS ONE, 2014. 9(4): p. e94238 [PMID:24736658] Zhao P, et al. ATHB17 enhances stress tolerance by coordinating photosynthesis associated nuclear gene and ATSIG5 expression in response to abiotic stress. Sci Rep, 2017. 7: p. 45492 [PMID:28358040]