PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG000230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 228aa    MW: 25253.6 Da    PI: 8.7843
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG000230.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.3e-1984138256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq+  Le +F++++++s+++++ LA++l+L  rqV vWFqNrRa+ k
  TRIDC3BG000230.1  84 RKKLRLTKEQTALLEGHFKEQSTLSHKQKASLARQLSLRPRQVEVWFQNRRARTK 138
                       78889************************************************98 PP

2HD-ZIP_I/II118.53.6e-3884172190
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                       +kk+rl+keq +lLE +F+e+++L++++K++lar+L l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l++en+rL++e ++Lr +
  TRIDC3BG000230.1  84 RKKLRLTKEQTALLEGHFKEQSTLSHKQKASLARQLSLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTKENRRLHRELQHLR-A 172
                       69*************************************************************************************9.4 PP

Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    
MFMAQEEAGL ALGLSLGLGA GHHHHHLLQQ KEAAPLEPCL SLSLAGAGAV KREEEEDEER  60
ALIYCSSAAD DHIEGYNSSS GGSRKKLRLT KEQTALLEGH FKEQSTLSHK QKASLARQLS  120
LRPRQVEVWF QNRRARTKLK QTEVDCELLK RCCETLTKEN RRLHRELQHL RALHHHQHHH  180
HHPAAAFFIP SAATAASVCP SCPGAPPAHA ADRPATKRSF FATKSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18389SRKKLRL
2133141RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-42HD-ZIP family protein