PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G37790.1 | ||||||||
Common Name | HAT22, T28I19.70 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 278aa MW: 30729.6 Da PI: 8.1506 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 55.8 | 7.9e-18 | 125 | 179 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ ++tk+q Le+ F+ +++++ ++++ LA++l+L rqV vWFqNrRa+ k AT4G37790.1 125 RKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 179 788899***********************************************98 PP | |||||||
2 | HD-ZIP_I/II | 121.7 | 3.7e-39 | 125 | 214 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +kk+rl+k+q++lLE++F+ +++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke ++L+ +l AT4G37790.1 125 RKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLK-AL 214 69*************************************************************************************9.44 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.6E-17 | 112 | 179 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.68E-18 | 120 | 182 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.941 | 121 | 181 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.5E-14 | 123 | 185 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 2.9E-15 | 125 | 179 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.48E-15 | 125 | 182 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 156 | 179 | IPR017970 | Homeobox, conserved site |
SMART | SM00340 | 7.7E-26 | 181 | 224 | IPR003106 | Leucine zipper, homeobox-associated |
Pfam | PF02183 | 1.1E-9 | 181 | 215 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009735 | Biological Process | response to cytokinin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 278 aa Download sequence Send to blast |
MGLDDSCNTG LVLGLGLSPT PNNYNHAIKK SSSTVDHRFI RLDPSLTLSL SGESYKIKTG 60 AGAGDQICRQ TSSHSGISSF SSGRVKRERE ISGGDGEEEA EETTERVVCS RVSDDHDDEE 120 GVSARKKLRL TKQQSALLED NFKLHSTLNP KQKQALARQL NLRPRQVEVW FQNRRARTKL 180 KQTEVDCEFL KKCCETLTDE NRRLQKELQD LKALKLSQPF YMHMPAATLT MCPSCERLGG 240 GGVGGDTTAV DEETAKGAFS IVTKPRFYNP FTNPSAAC |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 173 | 181 | RRARTKLKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.23912 | 0.0 | bud| flower| leaf| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 15028074 | 0.0 | ||||
Genevisible | 253038_at | 0.0 | ||||
Expression Atlas | AT4G37790 | - | ||||
AtGenExpress | AT4G37790 | - | ||||
ATTED-II | AT4G37790 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes homeobox protein HAT22, member of the HD-Zip II family. | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00477 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G37790.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | cytokinin |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G06710, AT5G47370 | |||||
IntAct | Search P46604 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G37790 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | ATU09336 | 0.0 | U09336.1 Arabidopsis thaliana clone HAT22 homeobox protein mRNA, complete cds. | |||
GenBank | AY087563 | 0.0 | AY087563.1 Arabidopsis thaliana clone 36691 mRNA, complete sequence. | |||
GenBank | BT002318 | 0.0 | BT002318.1 Arabidopsis thaliana clone C105403 putative homeobox protein HAT22 (At4g37790) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195493.1 | 0.0 | Homeobox-leucine zipper protein family | ||||
Swissprot | P46604 | 0.0 | HAT22_ARATH; Homeobox-leucine zipper protein HAT22 | ||||
TrEMBL | A0A178UXI6 | 0.0 | A0A178UXI6_ARATH; HAT22 | ||||
STRING | AT4G37790.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1671 | 28 | 86 | Representative plant | OGRP196 | 16 | 156 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G37790.1 |
Entrez Gene | 829935 |
iHOP | AT4G37790 |
wikigenes | AT4G37790 |