PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ro06_G28163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Rosoideae incertae sedis; Rubus
Family LBD
Protein Properties Length: 235aa    MW: 26447 Da    PI: 8.262
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ro06_G28163genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.51e-3314104191
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                  aCaaCk++r+kC ++C+lapyfp e++++f++vhk+FG+snv+k++k+++e +r+++++slv+eA +r++dPv G +g ++ +  +l+  k
  Ro06_G28163  14 ACAACKHQRKKCHEGCTLAPYFPVERNREFQAVHKVFGVSNVTKMVKNANEANRRKVVDSLVWEALCRQKDPVLGPYGEYRMIFDELKMYK 104
                  7****************************************************************************99888877777665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    
MQRKSNGTPG TAPACAACKH QRKKCHEGCT LAPYFPVERN REFQAVHKVF GVSNVTKMVK  60
NANEANRRKV VDSLVWEALC RQKDPVLGPY GEYRMIFDEL KMYKNLENQT VPLQVQKGMC  120
YKSLTDLVAW NYETNGISNG MDGGNGITST NNLDYDIHVN ENIRINSVPY GYPLSCDQES  180
EAEKIKQVKL AADSIVAPVV HQQGNSINTI NQQYYISGQL NQIMGKPLER TIWEG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-43LBD family protein