PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000666.1_g050.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 508aa    MW: 57027.9 Da    PI: 5.4603
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000666.1_g050.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.42.2e-1091275072374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                +elLle A+a+++++ +++q+l++ l+el sp+gd+ q+l++yf++AL +r+++s++++y++l + ++++ + +++ +++  f+
  Pav_sc0000666.1_g050.1.mk 127 QELLLETAKAIADKNSSRVQQLMWMLNELGSPYGDTDQKLTSYFLQALFSRMTDSGDRCYRTLISASEKTCSFESTRKMVLKFQ 210
                                589***********************************************************96655554444444444455** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetge 163
                                evsP+ +f+h+++N aI+ea++ge ++HiiD++ ++++QWp+Ll+aLa+R++++p+lR+T+v++ +++       ++ ++e+g 
  Pav_sc0000666.1_g050.1.mk 211 EVSPWTTFGHVACNGAIMEAFDGEPKLHIIDISNTYCTQWPTLLEALATRTDETPHLRLTTVVATRASdgsgapAQKVMKEIGA 294
                                **************************************************************998777899999999******* PP

                       GRAS 164 rLakfAeelgvpfefnvlvak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqea 246
                                r++kfA+ +gvpf+fn+++++ +l++l+l+eL+++ +EalaVn+v  lh++     ++ ++rd ++++++sl+P++++vve+ea
  Pav_sc0000666.1_g050.1.mk 295 RMEKFARLMGVPFKFNAVHHSgDLSELNLSELDIRDDEALAVNCVGTLHSIQ----AVGNRRDYLVSAFRSLRPRIITVVEEEA 374
                                ******************8888*****************************8....8888899********************8 PP

                       GRAS 247 dhnse....sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                                d++ +    +F+++f e+l+++ + f++l+++++r+s+er ++Er+  gr++v++vac+ +e++er+et+++W++r++ aGF+p
  Pav_sc0000666.1_g050.1.mk 375 DLDVGvdglDFVHGFQECLRWFRVYFEALDESFARTSNERLMLERA-AGRAVVDLVACAPSESVERRETAARWSRRMHGAGFSP 457
                                885444555*************************************.************************************* PP

                       GRAS 327 vplsekaakqaklllrkvksdgyrve...eesgslvlgWkdrpLvsvSaWr 374
                                v++s+++ +++++llr++k +g+ +    e  + ++l Wkd+p+v++SaWr
  Pav_sc0000666.1_g050.1.mk 458 VTFSDEVCDDVRALLRRYK-EGWAMTqcsEAGAGIFLSWKDQPVVWASAWR 507
                                *******************.5544443325566677**************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    
MDTLFRLVSL QSDHHQSFNN STTTRTSTPT TTTTTSSSSR SSFLSPPHQN PHPNYPHQND  60
DVEECFNFFM DEEDFSSSSS KHYYPSNHPT PPTPNPLLTT TTTPTPTDFS FSPALINFEL  120
SNGKWAQELL LETAKAIADK NSSRVQQLMW MLNELGSPYG DTDQKLTSYF LQALFSRMTD  180
SGDRCYRTLI SASEKTCSFE STRKMVLKFQ EVSPWTTFGH VACNGAIMEA FDGEPKLHII  240
DISNTYCTQW PTLLEALATR TDETPHLRLT TVVATRASDG SGAPAQKVMK EIGARMEKFA  300
RLMGVPFKFN AVHHSGDLSE LNLSELDIRD DEALAVNCVG TLHSIQAVGN RRDYLVSAFR  360
SLRPRIITVV EEEADLDVGV DGLDFVHGFQ ECLRWFRVYF EALDESFART SNERLMLERA  420
AGRAVVDLVA CAPSESVERR ETAARWSRRM HGAGFSPVTF SDEVCDDVRA LLRRYKEGWA  480
MTQCSEAGAG IFLSWKDQPV VWASAWRP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein